Nanoarchaeum equitans Kin4 M uid58009

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|41614986|ref|NP_963484.1| hypothetical protein NEQ191 [Nanoarchaeum equitans Kin4-M]
    MVVLGQKFPEVEVQTTHGRMRLPDHYRGKWFVLFSHPADFTPVCTTEFVEFARNYDKFKAMNTELIGLSIDQVFSHIKWI
    EWIKEKFNVEIPFPVIADDQGELARMLGMISPYKGTNTVRAVFIVDPEGYIRAMLYYPQETGRNIPEILRLVEALQTADK
    YGVATPANWHVDRYEFKPSSIVGNDVIIPPASSLEEKKDREERAKKGEIECFDWWFCHKKLE

    >gi|41615244|ref|NP_963742.1| hypothetical protein NEQ459 [Nanoarchaeum equitans Kin4-M]
    MPKLFSPQDAELLKKEFEKLKNPVVFGLVVDKDREPLHVHDETGHHDMDANEMAEMLLSDLKEISNGKIDYKVYDKSEKK
    EFCPEGESKYCGPILFFEDSPNVRYYGLPFGEEMPPFLDDIVTKGTGEPMLPPKAIELAKEIDQKLQEPIYVYVFITPT
    C
    PNCPYATEATHQLGLISNKVHAYMIEAYEFPDWADKYNVYGVPKIVIKDSKGNTLDEWEGTFRIPMACYERILEAINKL

    >gi|41615274|ref|NP_963772.1| hypothetical protein NEQ491 [Nanoarchaeum equitans Kin4-M]
    MFRISRTSFKPLDKQWDVIIIGGGPAGVVAGLYSARYGLKTLLISPDKGGMLTEASFIENYPGFISISGPDLAERLFEQY
    EKNGGHYLKDKVSDIKKDKNFIVITEGGYELEAKAIILATGSRRRKLNVKGENLPGVSY
    CAECDAPLFKGKTVAVVGGGN
    TAFHDALVLSNYANKVYLIHRRDQFRAESYLVENAKKKDNIEFILNSVVKEIRGQNKVESIIVQDKEGNTKELKVDGVFV
    AIGMETNIELAKKLGVQLDERGKIIVDRCQRTNIQYVYAAGNITNNCCDLDQIVTSMAQGAIAAKSAYEDLLK