Methanothermus fervidus DSM 2088 uid60167

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312136267|ref|YP_004003604.1| 1-cys peroxiredoxin [Methanothermus fervidus DSM 2088]
    MLIGEKFPSLDVNTTHGRIKLPDYFDGKWFILFSHPADFTPVCTTEFVAFQNKYEEFKKLNCGLIGLSVDQVFSHIKWIE
    WIKENLNIVIKFPIIADTGEVAKKLNLIHPKQGSNTVRGVFIVDDKSVIRAMLYYPQELGRNIDEILRMIKGFKTIEKEK
    VALPANWPKNELIGDKRIVPPPSNIKDAEKRKETYECYDWWFCYKKGD

    >gi|312136412|ref|YP_004003749.1| cob--com heterodisulfide reductase subunit a [Methanothermus fervidus DSM 2088]
    MENFIYDDVIIIHKNNYYLVIFMAEKKSEEPRVGVYICHCGVNIAGVIDVKAVREYAETLPNVVVARDYKYYCSDPGQEE
    IQRDIKELGVNRVVVAACSPRLHEPTFRRCVEEAGLNPFLFEFANIREQDSWVHMDDPEAATEKAKDLVRMAVAKARLLE
    PLEFEKVPVTRKAMVIGGGVAGIQAALDLADMGYKVYLVEKKPTIGGRMAQLDKTFPTLDCSI
    CILAPKMVDVGKHENIE
    LISYAEVKKVDGYVGNFKVTVEKKPRYVDEDLCTGCGSCIEVCPIEVPNYFDEGMGMSKAIYIPFPQAVPLCATINKDYC
    IECNLCDQVCERGAIKHDQKPEEIELEVGTIIVATGYDPYDPSEKYEYGYGVYDNVITSIELERLINASGPTEGKVVRPS
    DGKKPKRVAFIHCVGSRDEKVGNPYCSRVCCMYAMKNAQLIKEKKPDTEITCYYMDIRAFGKGFEEFYKRSQEKYGIKFI
    RGRPAEIIENPDKTLTIRAEDTLLGKTTEYTYDLVVLCVGLVPPEGIEELRQTLGLSKSPDGFFMEAHPKLRPVDTHTDG
    IYLAGVAQGPKDIPDAVAQASGAASRAAIPMSKGEVLIEPIVATVNEDICGGCGVCVELCPFGAIELKEGKAHVTVALCK
    GCGTCAAACPSGAMDQKHFRTQQIMAQIEAALGGTGEVTGK

    >gi|312136414|ref|YP_004003751.1| hypothetical protein Mfer_0186 [Methanothermus fervidus DSM 2088]
    MEILDPLAESAMKTVKINEISNVNTVSLVDNTKPNADIILKTIEKFLEVKKTLWVRKPAGAPANEKQIKNMEKGDLCILA
    VGD
    CGSCTTWLILDAIKLEKRGIPTISICSSKFKNFAENLAKAYGAKNLRILDIPHPIAGKKKEEIKKEVKKIIPKLNKL
    ISQQK

    >gi|312136492|ref|YP_004003829.1| 4fe-4S ferredoxin iron-sulfur binding domain protein [Methanothermus fervidus DSM 2088]
    MKRIVIKPELCKGCSMCMRACMKVQHAPNISVKKIDGEFRIVVCHHCKNAPCVEACPTGAMKINYVDTDKCIGCGSCALE
    CPFGAISIKNNVAHKCNLCDNLDYPACVRACPTKALTLIDVEKFIKRKKEEYLNKIKKVGSYTILDVLKFEVKAKKNLES
    SEAK

    >gi|312136632|ref|YP_004003969.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Methanothermus fervidus DSM 2088]
    MRVVIIGSGAGGLSTASNIRKYNKEIEIIVITKDKYVAYSPCAIPYVLSGKIKSFDEIIMHDIEYYLDKDINILTETEVI
    EISPTKNLIKYKRLDDTKIKELKYDYLVIATGGIPAVPPIPGVNLEGVFTVRTLEDGIKIKKWAENCEHATVIGAGLIGI
    EMAYGLKHLIPEVDIIEMASQVVPRSLDPEMAKIIQKYLEKLGVNVLVGKTVKKIIGEKRVNAVKLNNKKINTDMVLLAT
    GVKPNISLAKKAGIKIGKWGIKVNEKMQTSVRNIYAVGDCVEVKDFITGENTLSPLGSTAVRQAKVAAKNIIGKKCRFRP
    VLNAMVSRIGNLEFGSVGMTEINAKYHNIEAVCGMSKALTRARYYPGAERIYVKIVCNKDGKIIGCQVIAKEGVSERIDA
    MSIAISQHLKCSDLCEMEFSYAPPLSTVVDPFVPACEEIVEKLQNG

    >gi|312136734|ref|YP_004004071.1| thioredoxin reductase [Methanothermus fervidus DSM 2088]
    MRYDIIVVGAGPAGLTAGLYGGRQGDNVLILEKGRVGGKGLEIPYIENYPGYKKVKGMVLIEKMKEQVSPLVDIKELEEV
    KSIKHENSKFIVTTTKNKYLSKAVILATGTTHRELNVPGEKEFKGRGVSY
    CAICDGPLYINKNILVVGGGNSAVQEAIYL
    KSIGCKVKLVHRRNKLRAEKYLQKKLKDLNIPVIWDSVVEKIRGNNSVEEVVLYNKKTKEKKIVEVDGVFIAIGEIPLNK
    LARDLGVKLDKRGYVMTDEFQRTNVQHVYAAGDITHTPNQWIVACSEGAIAALTAHNDLLRGQK

    >gi|312136746|ref|YP_004004083.1| methylated-DNA/protein-cysteinemethyltransferase [Methanothermus fervidus DSM 2088]
    MISLAKYRDKYFAVSTLSGKVVSSSLGRKRPELAIKDLKIIVGNFSEDNSIAIKLGEAYYGKKVKFKILNLTTGFQRKVL
    EKVSEIPYGHVTTYKDIANSLETKAYRAIGNALSHNPLPIVIP
    CHRVVRSDHKVGGYRGGTRMKEEILKNEGIKIKNHRI
    LNFKKHYVELCVRQ

    >gi|312136905|ref|YP_004004242.1| redox-active disulfide protein 1 [Methanothermus fervidus DSM 2088]
    MVVKIEIFTSPTCPHCPSAIALAEEIKEEYGNKVEIEEIDVMENREKAIEYGLLAVPTIAINGEVKFVGTPSKEEFKRAI
    EEELKNE

    >gi|312136923|ref|YP_004004260.1| methyltransferase type 11 [Methanothermus fervidus DSM 2088]
    MKHCDYGKSSEKYLNAKEVLNKIEMEGCKRFLDAGCGNGFISIEVAKKLGKNGEVYAVDIHEPSIKKVREKIKNLNIKVK
    AILADITKKIPIEENSVDIYFMANVLHGIVANEKTDELMKEINRVLKPKGKLIIVDFRVDKPAGPPENLKISEEK
    CVEIL
    NSYGFKIENIDKLGKYHYIVTARKLQREGKT

    >gi|312136954|ref|YP_004004291.1| 4fe-4S ferredoxin iron-sulfur binding domain protein [Methanothermus fervidus DSM 2088]
    MIVINKEDCIRCGACQGVCPTGAISVKPEDVIYCDMCGGEPKCVEACPNDALRHEDITLEGGIKKKKITYSPEKCDKCGE
    CVKVCPPGILKLVNDGKASRVPLEGF
    CVLCQQCVNVCPIEVIGIEGVKEPARVEIKIDKPIYIVDCVGCGLCVPECPVNA
    ITLPKYGESIEIDEEKCIKCGICAQTCPWNSVYISGKKPQKRSRTIENFTLDKEECIGCNTCVEICPGGFIEPKSDLTVS
    LPEICPACGLCEKLCPTDAIELEVKLGPAKPVTEEGIVYNDENCKFCGRCALNCPNEAIRVVSPKGRVFPGLKKVDEKES
    YTICTTCGACTTVCPTGALKLVEVSKKVNGETVKRNRIQYNPSLCDKCGNCVDVCPYGILKLTDDEKLPVKGFCILCEKC
    IDACRFNALLLK

    >gi|312137150|ref|YP_004004487.1| glucose-methanol-choline oxidoreductase [Methanothermus fervidus DSM 2088]
    MMVVVIGSGAGGATVARELSKAGIDVKILEKGPYISPKEAYKCYEKDDKVLRTSCVGGTTLVSMGNALRTLEDELLKYGI
    DLSNEFRELEKELSISPLPDSHFGKGTKMLMDAAKSLNLPVKKMPKFIDPNKCEPCGKCPFGCPKDAKWTSLNYINESLK
    YGAKLYSNTVVKKILVKNDEVCGVLTNKGKIKDKNVVVAAGAIETAKLLKKVGIKAGEKFFMDTFITVGGILKSINFHKE
    VQMNMFIEMDKYILSPHFSTLLRDKLKCKNKDIIGIMVKIKDDSCGKIKNKKIIKYHTENDIEALCDGSVLATSLLEKIG
    VSPNTIVSTIPRGAHPGGTAPIGEVVDNNLQTKISGLYVADASVLPESPGAPPILTIMALAKRLSKYLLNSL

    >gi|312137184|ref|YP_004004521.1| tRNA (adenine-n(1)-)-methyltransferase [Methanothermus fervidus DSM 2088]
    MLTLIDERNKKYVVDGKKDFHTDLGVIKAEDIQNSKPGSIIKTHLGHEMKVIKANVNDYIDVMERRCTIILPKDIGIVIT
    YTGIGCGDKVVEAGTGAGATTLRFSRVLGNEGKIYTYEKRKEFYEIAKRNIEKFGVKNVVMRYRDIRDGIIESDVDLVFL
    DMPDPWNVVEHAYEALKYGGWFVSYSPYVEQMKKTRKKCEEFNFSEIFTYE
    CLLREMEIKNDAVRPKTRMIGHTAYITFA
    RKVP

    >gi|312137197|ref|YP_004004534.1| 4fe-4S ferredoxin iron-sulfur binding domain protein [Methanothermus fervidus DSM 2088]
    MEIETIHERSGKETRELIFNEEKCNVCGLCEKICPVNAIEVSPPGAVVREENISKLILDEDKCVLCGMCSSICPYDALDL
    QIDKKSIKDIPEYPTLIKSSEIDEEKCIYCKSCEIVCPQGAITITRELPERSELVTGEIEIDKDKCIFCGVCEEMCPAAA
    IEIEWKEPTSIDPSTANDIRVDEKKCVY
    CMICKRVCPVNAIKVICKVCPYGEYEIKEPEIKGSTYIDSELCVNCGWCQET
    CPVDAIKIEKPFEGTVEINEELCQGCATCVEVCPCNALSFPKPSKPGEKPQKLHIEEKFCVYCGACEKACPTDAIKVRRT
    NIKHTPILSKAWKVRFDSLKE

    >gi|312137271|ref|YP_004004608.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Methanothermus fervidus DSM 2088]
    MYVIIGGGPAGRFAAMELAALNKETLLIEKKYMGGTCLNEGCMVVCGLNDIARFIDNAKNLKNHGIIDFECEIKYKHLLK
    KLKKTIKTIRKINEKETKESGVEIIYGEAKVIEDKVQVDGEKISYDKLIVATGIKPHIPPIDGVENAITYRDVLEIDELP
    EVINIVGGGHTASEFAYIFSRFGCKVNVICRSKFLKNLDPEIKKYVVEKLLDDVKIYENTKTLKIGEEYIETSKGKIEGK
    TFLATGVTPNSKIVNVKKDSKEHIIVNEKMETSMKNVYAAGAVTNRAKNTPVARMEGIVAARNAAGIETRMRYDYIPNSI
    SLKYDVAFIDENKNKKLVNAKMPGPAGPGSFWEVLNKNTGLSKVSVDLNTGEISRVYAVSPIGRDYVAYLSHLLRLGSKV
    QDFDNFIEVHPSTDSVYKLLRFLAKRI