Methanothermobacter marburgensis Marburg uid51637

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|304313784|ref|YP_003848931.1| peroxiredoxin-related protein [Methanothermobacter marburgensis str. Marburg]
    MRINLRGINRYAAAIITDNILKNGQENIQLILRENYEEIQKVAASYGMNYSAKKGPDGVVVDISRGEIEEVDVTGETCPG
    PLIIVGEKLSSMKQGMRIKIKSESQDVIDDLAVSAPEMNARVIEKSKTHLILEKIEKTEKKEFTGRDRVLVVQSNGTGNA
    ERAYATFIFSKAALSMGKDVTVFLLMDGVSLARRGAAAKVKHPAFPTLNELMEEVIEMGAKVYV
    CEMSAQFRGLTEDKIT
    EGCKIAGAATFITLLSDPRYAVVNF

    >gi|304313893|ref|YP_003849040.1| cation transport ATPase [Methanothermobacter marburgensis str. Marburg]
    MKRITIRIGGMGCAACALKIEDSLKKLEGVSDAVVNLVEGRVSVEYDPETVGLPSMEAAIEEAGYSVINEHLTVLVGGMS
    CAMCAQRIESALKELEGVSDATVNLAAEKAYIAYNPSLASAEDFRRTIEDLGYEFMGTEGDEEIQEDQGPKLRRIAVGFG
    VSLPLMAMMYLGIHPPVNEGFFMLLVSVVPFAYVSGPIFRGALRSLRSGTLDMDVMYSMGIGVAFLSSLLGTVGVLPSSF
    MFYETALMLASFLTLGRYLEARAKGKTSGAIRRLMELQPDTATILRDGDEVEVRADELVEGDEVVVRPGDRIPADGRVLD
    GESYVDESMITGEPLPVLKTRGSEVIAGTINTDGVLRFKVERTGDETFLSRIIGLVDEAQASKPPVQRIADRAVSYFIPS
    VLMVALAAFLYWYLVEGAGLLISVTVLISVLVVACPCALGLATPTAVTVGIGRGAELGILIKKGEALEVAGRISCVLFDK
    TGTLTEGKPEVTDIVGDVLGYAAALEARSRHPIAVAVTERVMREGLEIPGVEEFRAIPGKGLEGKINSQHVIAGNRVLMD
    EFGVEIPADAGKLESEGKTVVMVAVDGEFKGVIAVSDRINPGATAAVGELERMGIRTAMITGDNRRTAEKVAREVGISTV
    IAEVLPEDKASRVSDLRSRGVGVAFVGDGINDAPALSEADLGIALGGGTDVAKEAGEVVLVGDDPLDTAAALQLAGKVIS
    RIKQNLFWAFAYNVILIPVAAGALYPLGVVFRPEYAGLAMALSSVTVVSLSLSLRGYTPPARRLREL

    >gi|304313902|ref|YP_003849049.1| hypothetical protein MTBMA_c01270 [Methanothermobacter marburgensis str. Marburg]
    MKVKIIEREVMDPLADTSMDEIPVNSIGDAGTISLFDNTKPGADIILRTLESELSGFNFIWSEKPAGAPAEAEQIERAAR
    GDLCILALGD
    CGSCTTWVILDAIRLEGMGVPTISICSDRFSEYARRLASAHGMPGLRIVEVEHPIAGLEPEAVRRKAEKL
    IPSILDHLR

    >gi|304313915|ref|YP_003849062.1| tungsten formylmethanofuran dehydrogenase, subunit F [Methanothermobacter marburgensis str. Marburg]
    METTEVIEGKNITVERTGEENRKLIFQDCLCAVCGLCGEICPVSAIEVNPTGAMVRTEQDESKILIDENKCVLCGMCSSI
    CPFQALDLQIDGTSIKELAEYPKILKSAEIDDETCIQCKACETACPQDAITITRELPERKDLITGEIEIDKDTCIYCGMC
    EEMCPVDAIEIEHQIPSSSSPTVATDINVDEDKCVHCGICKRICPVDAIMQVCRICPYGEYEIKVPEVTGTSYIDPELCV
    NCGWCQEICPVDAATVTKPFEGELIIDQDTCQACETCVMACPCNVLSFPKPEKSGEKPTKLYKDERFCIYCGACERSCPV
    NAIEVKRSRINTTPIKSKAWKNAFESLLK

    >gi|304313938|ref|YP_003849085.1| glutaredoxin [Methanothermobacter marburgensis str. Marburg]
    MKFEHVDGSEKAEIRLFALSTCGWCKKTRELLDELGVAYDYIYVDLLHGDEREKALSELRKWNPSLSFPTLVIDDGDVIV
    GFDALSIKSALR

    >gi|304314006|ref|YP_003849153.1| dihydrolipoamide dehydrogenase-related protein [Methanothermobacter marburgensis str. Marburg]
    MKCVVIGGGPAGRAAAMELAALENDVTILERKFIGGTCLNEGCMVVCGLNDVARFLDEARKLRDLGVVDLEYSADYRRIV
    AGVRETLSRIRHVTERETLDAGVEIIYADAEVSEGKVIAGDDELPYDRLIIATGARPGIPPIEGAEKAITYRDVLDLERI
    PEKLVIIGGGVIAAEFAGIFSSLGSDVTVVSRSEFLGKLDPLIRDYVMRKLLKDVRILENTSTTSIDEDGAETSAERIEG
    LTLLATGQRPNSEFLDGFVELRENGAVKVNERMETSRKHVYAAGDVTGGQGTTPVARMEGVVAGLNAAGVERRIDYRYLP
    YAISLGYDVGFIETGNPEGREAVIPGLAGPGSFWSVPEGKTGLNKVRIQDDGTAAAVYSVAPGARLIMPYLSLLMRMGVS
    MYEFEGFVETHPSTDGVYKLMRFLSRY

    >gi|304314093|ref|YP_003849240.1| thioredoxin-related protein [Methanothermobacter marburgensis str. Marburg]
    MDVIRKWVISGVLLGLMVVLLIYSTQPHNTPQKNEAQNREFRWYKSPQEAIDEASKQNKRVILIFSASWCPSCSKLEEET
    LQNQDVLGKISENYIAAKIDVDSDPSAASSYGVYVVPTTIILDSSGGEIGRREGYMSPEEFISYLG

    >gi|304314371|ref|YP_003849518.1| peroxiredoxin [Methanothermobacter marburgensis str. Marburg]
    MGEKVYELRKVKKKGRGMPLIGDKFPEMEVQTTHGLMKLPAEFKGRWFILFSHPADFTPVCTTEFVAFQEVYPELRELDC
    ELVGLSVDQVFSHIKWIEWIEENLDTEIEFPVIADTGRVADTLGLIHPARPTNTVRAVFVVDPEGIIRAILYYPQELGRN
    IPEIVRMIRAFRVIDAEGVAAPANWPDNQLIGDHVIVPPASDIETARKRKEEYECYDWWLCHRSASGD

    >gi|304314487|ref|YP_003849634.1| dehydrogenase [Methanothermobacter marburgensis str. Marburg]
    MVTEVDVLVIGAGPAGSTAAKHAAMGGASVLLIDKKSEIGAPKRCAEGVSVGGLESLGIEPNPRWITKKLDGVRLVSPNG
    TDVWLTSDKVELPEAGYILERKVFDKHMAMDAARAGSEIMVKTLATGMEKTDDGYLVSAECMGREFEIKARIVIAADGPE
    SRVARWAGLNTATKPKDMESAAQFEMVGVEMEDNNCIEFYFGSVAPGGYAWIFPKGDDIANVGLGVLSTETDKSAYEHLV
    EFVESCPATRNAQPVELNIGGDPVGGMPKELVADSLMVVGDAAGQVNPLTGGGIISGMTGGMLAGRVAAAAVSEGDVSKK
    RLSEYERLCREEIGKEIDRYLKVKDYMLTLSDSELDSIAEAFQDVEFEKVSTTELVKKLIKVSPKALIKLGKLF

    >gi|304314683|ref|YP_003849830.1| peptide methionine sulfoxide reductase [Methanothermobacter marburgensis str. Marburg]
    MKKYRKATFGAGCFWGVEDAFRRIRGVVSTRVGYMGGHMKNPTYEDVCTGLTGHAEVVEVTFDPALVSYSELLDVFWSIH
    DPTSLNRQGPDVGEQYRSVIFYHDDEQRRLAVESRRKLEESGRFTGKIVTAIEPAGTFYEAEDYHQQYLEKNRTQRCYLR
    RLL

    >gi|304314760|ref|YP_003849907.1| methylated-DNA-protein-cysteine S-methyltransferase [Methanothermobacter marburgensis str. Marburg]
    MNSPIYTLISRTFKCMYMLRHSLACIGLKCAGGRVQRVFFIRGRDVGVNVSPTDSGCESISGVLDSLNRFLDGEDVPFDP
    AVLDFRVCTGYQRGVLRVVMGIPRGSTMTYAEVAGAAGGGPRSVAGALARNPFPLIIP
    CHRVIRSDGKPGGYQGGVDLKV
    RLLEMEGAHFKI

    >gi|304314764|ref|YP_003849911.1| thiosulfate sulfurtransferase [Methanothermobacter marburgensis str. Marburg]
    MEPYGGGDGRVRWVTPEWLMENLEKVAIIDCQPNIHDYILEHIPGAVYLNEGLFREPRGIAPAMYIPWDAAESIFRQAGV
    ENKPTVVYTGTGGFKGWGDGLEQTMVAYSLARFGHEEVLVLNGGLAEWKNAGGEVTKVFPEVRESEFSVKVQGDFYIEYP
    DFRRIKDDDDVLVLDARPPEVYEGQGPWIKPGHIPGAVNLPWASLMDDENKTLLKPEDEIRELLDSVGATPDKKIICS
    CG
    TGREATNEFLLFRWYLGYPDVKIYEGSFTEWTQIEDNPTVTGPNPY

    >gi|304314856|ref|YP_003850003.1| thioredoxin reductase [Methanothermobacter marburgensis str. Marburg]
    MTDYDIIVIGAGPAGLTAGIYGGRQGSRVLMLDKGPAGGLGLEVPMMENYPGFEMIAGMSLVTKMKKQATKVAELREMEE
    VKEIEKDDVFTVRTSRDTYTASALIFATGSRHRQLGVPGENELLGRGVCY
    CATCDGPLYRGRKVLMVGGGNSAAQEAVFL
    KNIGCDVSIVHRRDELRADRYLQEKLKEMNIPVIWNSVVTEIRGDDRVEEVMIHNRVTGEDEALKVDGIFISIGEEPLNQ
    LAVELGVEVDDGGYIITDKRQRTNIPLVYAAGDITGGLNQWVTACAEGAIAATYAYSEIQRL

    >gi|304314862|ref|YP_003850009.1| methionine-sulfoxide reductase [Methanothermobacter marburgensis str. Marburg]
    MVEKIELTVEEWREILEPEAFRVARCGGTEPPFTGEYHDFHGDGIYRCVCCGTDLFDSETKFDSGTGWPSFYDTISEYNV
    ELREDRSLGMVRCEVLCARCGAHLGHVFDDGPLPTGKRY
    CMNSAALKFIPRSQIR

    >gi|304314907|ref|YP_003850054.1| hypothetical protein MTBMA_c11480 [Methanothermobacter marburgensis str. Marburg]
    MKGKEFTNSLINEKSPYLLQHAHNPVNWYPWGDEAFQLAGEEEKPIFLSIGYSTCHWCHVMARESFEDPEIADILNENFV
    AVKVDREERPDIDAIYMKVCQMMTGTGGWPLTIIMTPEGEPFFAGTYFPPDDRGGVPGLRTILERVVLLWKNDPDGIVKT
    ARDVVSALKKSVAKASKLKPETVDAAYEYLRRNFDTRNGGFGSYQKFPTPHNIYFLLRYHLRRGDDEALRMVNLTLRRMR
    YGGIYDQLGYGFHRYAVEPTWTVPHFEKMLYDQALILKAYLEAFQVTCDDLYKKTALEIVEYVLGNLQSPEGAFYSAEDA
    ESEGVEGKYYLWRASEIREVLGDDANVVMRYFNVLEDGNFAGDVRGENILHIGSPWRVADEFNLTLDELNEIIENARRHL
    LERRMERPTPALDDKILTDWNGLMLGALAACGRILDSEEALAAAERCLKFIMDNLHVDGELLHRYRDSEAGIDGKLDDYA
    FLIWGLLELHDATFREGYVEMALELSESLEDRFGAPDGGFYLTDDPKLIVRPMDATDGAIPSGNSVQMLNLLRLGGILED
    DDLTESARGVMRAFAGDVESAPAAHTFLLSNLEWAISGGRSLTVVCSGNPVIPVELMKKLIPDFTMTVMPRDWPIAPPHL
    RGKRAPPEGCAYYLCDGSRCYPPLNDPRDVMEHLGVI

    >gi|304314959|ref|YP_003850106.1| thioredoxin [Methanothermobacter marburgensis str. Marburg]
    MVVKIEVFTSPTCPYCPMAIEVVDEAKKEFGDKIDVEKIDIMVDREKAIDYGLMAVPAIAINGVVRFVGAPGREELFEAI
    SDEIE

    >gi|304315044|ref|YP_003850191.1| redox-active disulfide protein [Methanothermobacter marburgensis str. Marburg]
    MKIQIYGTGCANCQMLEKNAREAVKELGIDAEFEKVKDMDEILEAGLTALPGLAVDGELKIMGRVASKEEIMKILS

    >gi|304315075|ref|YP_003850222.1| DNA-binding protein [Methanothermobacter marburgensis str. Marburg]
    MKTGADRFLGELPEVAESFKNFREAVRSEGKLTEREKLLISVACSVAVRCDACTRRHAEEALEAGITEGELAEAAAVAAL
    IRAGSAMNTASAIFRD

    >gi|304315226|ref|YP_003850373.1| hydrolase [Methanothermobacter marburgensis str. Marburg]
    MIFEIIRSEGLSHNSYFLASGGEAAVVDPRRDVDVYLELAEKNSVNIRYIFETHRNEDYTIGSVELARYVDAEILHGAHL
    DFEYGTAVVEGDTFRLGNLELEVLETPGHTYESISVAVRDTTVSDECLMVFTGDVLFAGETGRVDFFGPEKIPETAGLLY
    DSIHEKIIPLGDHVVVCPAHGAGSVCGADIRDMDTTTVGYERLTNPYLQMGRDEFTEHKISERLYTPPYFRRMEENNLRG
    APVENPNLEALPVPEFRELLAESAQVVDVRNPTSFSSGHIPGSLNIWQDGFAAFAGYFLNYDDPVLVVDDGRGVESVRRS
    LIRLGYDNMAGYLAGGFPSWYMAGLEFNAIRSMSVHELRELEGDIFLLDVRKITDRERFHIEGSEHIWVGDLPDNVDMIP
    EKDVVIY
    CDSGYKSTIAASILESHGFSTTTVLGGIGAWLRAGYPVVEV

    >gi|304315261|ref|YP_003850408.1| F420-non-reducing hydrogenase, subunit B, polyferredoxin [Methanothermobacter marburgensis str. Marburg]
    MIVVNKEDCIRCGACQGTCPTAAIEVTPEDVIYCDICGGEPKCVDACPTGALKIEDLVVDEAGNTQGRIVFNPDKCNECG
    DCVEVCPPQILKLDEGKVKKIPLQGF
    CVMCQKCVDICPVGVIGVEGIKEPAKVELEIEGPIFIADCVGCGMCVPECPVDA
    ITLEKVGGVIEIDEDTCIKCGVCAQTCPWNAVYISGKKPEKRAKEIRKFELDEEACIGCNTCVEACPGDFIVPKSSNLTV
    ELPAICTACGLCEQLCPVDAIDLDVELGPAKPASEEGLVWDEGKCDFIGACANICPNDAIRVVTREGMKLPDNEKVDEEP
    SFAMCTRCGACTMACPKGALSLVDMDKVIDGEVVKRKRVQYNPALCDQCGDCIEACPYDMLKLTDEKVPLKGFCILCDQC
    IPACPKGALSLK

    >gi|304315478|ref|YP_003850625.1| dehydrogenase [Methanothermobacter marburgensis str. Marburg]
    MRVVIVGGGAGGLSTASNIRKYDKDAEITVITRDKHVAYSPCAIPYVMCGEVECFDDIVMHQPEDYRERNIDILTETEVE
    EVDSHKKTVTYVKDGKRHEIPYDVLVLATGGSPFIPPVEGVDLEGVFTIRTLTDGERISEWASKSKKAVVVGAGLIGLEI
    AYGLLKMGLEVTVTEMLPQIVPRSLDPDMAAIVQEYLEEKGIRVVLGKALERITGDERVEAVAVGDECIEADLVVLATGV
    RPETKLARMAGCELGQWAVRVNERMQTSVPDIYAVGDCVEVYDAVTGFRTQSPLGSTAVRQARVAARNIVGLDATFRPVL
    NAMVSKIGELEFGAVGLTEVMALQSGIKVVSGKKRALTKARYYPGAERIDVKMICDLKGRIIGCQMVAKERVAERVDTMS
    LAISQGLTCSDLAWTEFSYAPPVSMVIDPIILAAEAACEKLKRVNSKQDD

    >gi|304315481|ref|YP_003850628.1| hypothetical protein MTBMA_c17470 [Methanothermobacter marburgensis str. Marburg]
    MEKKLLTIVLLEGPYRHQYADIASELAESAMKNGYDVNIFLYMDGTHVPKRDQAPQSFPNVAEKFRALVRSGVNVISCIR
    CSTARGYTCSEKPYIKGVEIKSVYELAEWIKKSHRVISLGC

    >gi|304315502|ref|YP_003850649.1| CoB-CoM heterodisulfide reductase iron-sulfur, subunit A [Methanothermobacter marburgensis str. Marburg]
    MAEEKKETMEEPKIGVYVCHCGVNIGGVVDVEAVRDYAAKLPNVVIAKDYKYYCSDPGQLEIQKDIKELGINRVVVAACS
    PRLHEPTFRRCVEEAGLNQFLFEFANIREHDSWVHMDNPEGATEKAKDLVRMAVAKARLLEPLEASKVSVDDKALVIGGG
    VAGIQAALDLADMGFKTYMVEKRPSISGRMGQLDKTFPTLDCSM
    CILAPKMVDVGKHDNIELITYAEVKEVDGYIGNFKV
    KIEKKPRYIDEELCTGCGSCVEVCPIEMPNYFDEGIGMTKAVYIPFPQAVPLCATIDKDYCIECMLCDEVCERGAVKHDQ
    EPEEIEIEVGTIIVATGYDAYDPTEKLEYGYGRHTNVITGLELERMINASGPTDGKVLKPSDGEKPKRVAFIHCVGSRDE
    QIGKPYCSRVCCMYIMKNAQLIKDKMPDTEVTLYYMDIRAFGKGFEEFYKRSQEKYGIKFIRGRPAEVIENPDLTLTVRS
    EDTLLGKVTEYDYDMVVLGVGLVPPEGAETLRQTIGLSKSADGFLMEAHPKLRPVDTLTDGVYLAGVAQGPKDIPDAVAQ
    ASGAAARAAIPMVKGEVEIEPIIAVTDSDVCGGCEVCIELCPFGAISIEEGHANVNVALCKGCGTCVAACPSGAMDQQHF
    KTEQIMAQIEAALNEPASK

    >gi|304315004|ref|YP_003850151.1| hypothetical protein MTBMA_c12500 [Methanothermobacter marburgensis str. Marburg]
    MVLIVGSGASGATLARELAVGGFDVTVIERGPYVQDRDAFLCYDESSDDPDILKTSCVGGSTLVAAGNAVRVLEDTLKDY
    GVDITDDLDAIERELDVRELPDTHIGRGTALIMDAAESLGLEIRRMPKFIRPEKCRPCGKCSFGCPRSAKWSAREFMDEA
    IEHGAVLVKETEARDLILEGGKVRGLETSAGSFHDETVVLAAGAVETPRILMRAGIDAGRKFFMDTFVTVGGILDGIGFC
    DEVQMNALIEMDGFILSPHFSTLLFPERNRSDVLGLMVKIRDEACGRVEANRVVKHHTQRDVRYLAEGAALAGAVLSEAG
    VRADTLRSTRPRGAHPGGTAAIGDVVDANLETSIQGLFVADASVLPEAPGAPPILTLMALARRLARHLTSDI