Methanospirillum hungatei JF 1 uid58181

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|88601566|ref|YP_501744.1| MarR family transcriptional regulator [Methanospirillum hungatei JF-1]
    MDPTSRLRLSLGFVSTVMSMIFGTNKGRKNLLSPGAIEILYSSYFSRICMGDIAGMLEISPSSATDLVNYLEREGYVRRV
    PDTENRRSIQVIPTEKGEEWILSTEEKIYGFLESGLSRLTPDEQKQFADLCTRFSGVHDTASFTSSLRTFRETGSQNRIS
    LIQRRNGRLLRLEEVVDGRYAHSHETDIKEEQMTLKPRIPETSEGIQDEITVEQYDHMQRGLRDNGHLPVEELIRASKPG
    DSALEIGPGPGYFGLEWLKHTKKTHLTGLEISPAMIRMAEKNSKDYGLSDRSIYHEGNALSMPFADNSFDLAFSNGSLHE
    WEDPGKVFSEIFRVLKPGGELRVSDLRRDLSPEIYQFMLDS
    CKGPEIKKGFQTSVQAAYTKEELEILLQDIGFTWVQVIA
    HPYGLVAVGKK

    >gi|88601826|ref|YP_502004.1| UBA/THIF-type NAD/FAD binding fold [Methanospirillum hungatei JF-1]
    MKKIPPSYLSSRFERQLPLIGHEGQKKLENSTILIAGAGGLGSPAATYLALAGIGELIIVDDDRIQESNLNRQFLHAAAS
    VGLQKVYSAEATLGSLAPDTSVVAYPGRIDEGSADRLVADADVVIDALDNYETRFILHESAWNADIPFIHGAIEGFSGQM
    TSILPGQSPCLS
    CLIPAAPPGGKVPVIGAVAGVIGSIQAMEAIKYLTGTGSMISGRLFLWDGQAGRSEFLTIGKRKNCPV
    CSYKGDNE

    >gi|88601919|ref|YP_502097.1| 4Fe-4S ferredoxin, iron-sulfur binding [Methanospirillum hungatei JF-1]
    MNNAVVIGGGIAGITAALDIANHGVHVALIEREPTIGGHMAMLDKTFPTNDCSMCILSPKMVEVERHPTITLHTCSEVIG
    VEGEAGNFSVHVLRHPRYVRAADCTGCGDCVEVCPVEVYNRFDAGIGVRKAIYKAHPQVVPNVVIRDKEHCIDCGLCYDI
    CGKQAVLRDSEDAEEELVIKAGTIVIATGYAVFDARKKTPYKYLSIPDVITSLELERIINASGPTGGKVKRISDGQPPKE
    IVFIQCVGSRDLPLGCPSCSAVCCMYAIKNAMLIKEKNPDTRVTILYMDIRAYGKGYEEYYARAEQLGVRFIRGMPGDIY
    AQDGTIIVQVENSETKDVLKIHADLVVLSVGIRPTGNASTLAERLGITCDESGFFESVNVKSGPVQTLKPGVFIAGTCKE
    PMDIPDSVMEGGAAAMQAVMSLMRG

    >gi|88601949|ref|YP_502127.1| peptide methionine sulfoxide reductase [Methanospirillum hungatei JF-1]
    MGIAFFAGGCFWGIEAGFQKVPGVINTKVGYMGGHTIEPTYQEVCSDTTGHAETIALEYDDTAITYRKLLEIFFSLHNPT
    EVNRQGPDVGSQYRSVIFYTSPEQKEEAEMFIAEMNQSGRYHAAIATEVVPAETFWPAEEYHQSYFLKIGQRYGRSLF

    >gi|88602094|ref|YP_502272.1| protein of unknown function DUF395, YeeE/YedE [Methanospirillum hungatei JF-1]
    MLDLLFETEWSPYLAGAGIGVLLWCSFLFSNKPLGCSTAFSRTSGMIESIFCPDKVKNKEYYKMFAPEIEWQWMMVFGII
    LGACLSSVLSGTLQISFIPQTFQAAFGDNILLRFLMALVGGIMMGLGARWSWG
    CTSGHGISGMSQLSLASLVAVMGFFIA
    GIGTAMILYSW

    >gi|88602108|ref|YP_502286.1| thioredoxin-related [Methanospirillum hungatei JF-1]
    MAQDVLVDISDSDWEPMVERNEKPVFVMFYSPSCTHCIRIMPSIEELARDFGTEIAFVKLNLIRFDYIGERYGVMATPTF
    IYFCGGKPVQTRVGAVFPAMLRKMVEDMVIHGEECRLASSDWKYKITGYG

    >gi|88602153|ref|YP_502331.1| redox-active disulfide protein 2 [Methanospirillum hungatei JF-1]
    MKLEVLGTGCTKCKRMYDNVTEAVKKSGVLAEVTKVEALEEIVSRGVMMTPSLFLDGEEVVAGRVPTVNEIIEIIKENA

    >gi|88602219|ref|YP_502397.1| glutaredoxin, putative [Methanospirillum hungatei JF-1]
    MLYALSTCIHCKQTRKLLDELKVAYDYLYVDQLSRSEMDEVLKEMEKVNPRGSFPTLVINNNKVIVGSRLDEIREALLS

    >gi|88602255|ref|YP_502433.1| methylated-DNA--protein-cysteine methyltransferase [Methanospirillum hungatei JF-1]
    MEGSARFGLWFVYIRWDSDNVVSRIRFVRQGVSGPVPLSLSQYLAGKTTTLSPLSSLHEQDDTVFGRIYREVKTIPYGET
    RTYKEIAESVGTGARVVGMAMKRNLTPILIP
    CHRVVSTGGLGGYTPDISIKQDLLNLEERVRKRMGITNSSLHLS

    >gi|88602273|ref|YP_502451.1| copper-translocating P-type ATPase [Methanospirillum hungatei JF-1]
    MAEENKKEIELEISGMHCATCAVTVEKSLSSTPGVMESKVNLATGKARVLYDPSQVSVSDLTGAVEKSGFSVKFEKAVIK
    VGGMT
    CASCVQTVQKALQTLDGVISADVNLSNERAYITYNPSLVDIKKIRDVIDNAGYQFLGTDRDEIDESEKLLEIQLK
    KQFFKIIIGFSLSLVLMGMMYIPDHDMHLMSYVQFLITTPVLFWLGTPIFRAAFGALRNKTLNMDVMYAMGISVAYLASV
    LGTFSIILDMNMLFYETALMLTAFLSLGRYLEARAKGRTSSAITSLIGLQADSASVIRDGVEIDIPVQEVIPGDIIRMRP
    GGRIPVDGIVVSGSSYVDESMVTGEPLAVLREPGQEVIGGTLVTNGAFIYKATRVGSDTMLARIIRLVEEAQGSRPPVQR
    LADYAVTWFIPVVLLIAFLAFLYWYGIRGMDLRFSLQTLIAVLVVACPCALGLATPTAVTVGIGRGAELGILIRNGSVLE
    IADKITVALFDKTGTITKGKPVVTDVDSFIGNPRLLLSMAASLEILSDHPISSAILAKAHHEGIEPAEVTSFQNISGSGL
    SGTISGGVVRLGTRDFIVSEGISFVSNEEELVTRREREGKTTILISRDDQILGLISIADQVKPEAERAVRLLKEMGIRSG
    MVTGDNQITADAVASMVGITDIFARVLPEGKEDQVIQIQNNGNVVAFIGDGINDAPALARADTGIAIGSGTDIAIESADV
    VLVRDSLIHIPAALQLARKVMGRIRLNLFWAFAYNIVLIPLAAGILYPVITFRPEYGALAMAFSSVTVISLSLLLKQYTP
    PALMQEMKSGMYMNKEIDPICGMSVDPNTAQFKSTYEGKTYYFCNKGCKDTFDKNPEQYKK

    >gi|88603096|ref|YP_503274.1| 4Fe-4S ferredoxin, iron-sulfur binding [Methanospirillum hungatei JF-1]
    MSTLFPKYSKTTDGSKVIMEQRLLQQVNNLILDNDICTGCGICSEVCPEEAISVGAVGGVRRGLVDDAASIHVDETKCSY
    CGVCVIMCPFSALALKVDGEERLPILEKEGFPTYDKGTAIDQDKCVRCNICDDVCPRDAIDRDVPLFEGEDKEGLAKGQA
    VELKIEFKVDDEKCTKCGI
    CGNLCEAINVLHKPFSPEIGKVEGEVIWDEAYCDGCNVCAEACPSEAIKVTRTVVGQKKLG
    NVNIIDEDCCTCRWCAINCPTEAITVNKIFEGEITFHAEKCPGGCSTCVDVCPANAIYLPTPKPAKDMKGQIEAKIAVNK
    DFCILCGACVNACPGEDIIYLRRDSVKIKGKETDLFKKIKEKLFTPRTSKVKEQPSLAGSVELKAVSQ

    >gi|88603099|ref|YP_503277.1| 4Fe-4S ferredoxin, iron-sulfur binding [Methanospirillum hungatei JF-1]
    MAENTEPRIGVFVCHCGTNIAGSMSIDDVVNYAKTLPYVAVADQYQYMCSTPGQKKIDDAIKEYNLTGVVVAACSPRLHE
    PTFRTATKEGGLNPFRFEMANIREQNSWVHMHGMWDEATQKAKDQVRMAVAKAAKLEDLVPKSVPVEKTAMVVGGGVAGM
    QAALDLASAGIKTYLIERTPTIGGRMSQLDKTFPTLDCSQ
    CILTPKMVDVGRHPNIEMMTYTEVEKVEGYIGNFDVTLRK
    KARGVLTPTEATAKGIVGGGCNGCGDCSAVCPVIKPNPFEMGMAPRKAIYIYHAQVMPLIYTVDFDSCVKCGLCVEACGD
    KKAIDLEMQDEFITVKVGTAVLATGYELFPIENKREWGYKQFDNVINALEFERLICASGPTGGHLVRPSDGKTPMKVGFV
    LCAGSRDNTGIGKPYCSRFCCMYSLKHAHQIMEKIPGAVAYLFYMDIRSFGKMYEEFYYRIQHEGAKFIRGRVANVLEDK
    ETKNLHVFTEDTLLGRPVDVEVDLLVLAAAVQPNEGANELRKKFGVSASQDGWMLEAHPKLNPCGTTTAGVFLAGVCQGP
    KDIPDTVAQAEGAASAASIPIHMGEVELEPYFAMCIDELCAGCGMCVNLCPYSALSLGEKNGRTVMVVTEAKCKGCGTCG
    GFCPGGAIKMQHFTTPQIVAQIDAFFAGGEQ

    >gi|88603544|ref|YP_503722.1| alkylhydroperoxidase AhpD core [Methanospirillum hungatei JF-1]
    MGKPKNGFEKIIKEVLEKGAAETAQGWVEAIRKDYGRAPLIFERMSERPEVLISHLLYKNSVLKTGTLDPKIVELISLAV
    SAALRCNH
    CTDYHVQAALRKGANPDEILEAIMIAGLTSQSTVLADAYRTYSDTIEECISCGVKIPDNAHKD

    >gi|88603594|ref|YP_503772.1| hypothetical protein Mhun_2349 [Methanospirillum hungatei JF-1]
    MSYHRTILPVVFGLLVMTLLCTGCLASEESPEIAYSETASPELAWITTSMTDVATGERFTIKDLAEQGKPVIIHSFAVWC
    PGCSMQLLESTKLLTAYPDKYVVVALDVDPNDNAEKVRRHQESNNFKGIFTAAPTDVTRSLIKAYGPGFIQSIPQTIIIC
    DKTATYLEDGVFRADVLKRALDELCS

    >gi|88603732|ref|YP_503910.1| beta-lactamase-like [Methanospirillum hungatei JF-1]
    MIIRQFFIPGIAHSSYLLGGVSSCMIIDPARDPDIYIQAADEEGFRITGILETHLHADFISGHLDLHERTGAPIYAPKSA
    GCVFPHIPVSEGSTITLDDCSISVIETPGHTPEHVSYIVTHMSRGDEPAALFPGDTLFVGDVGRPDLFPGRAHELASALY
    DSLHEKIMKLPDYCEVYPAHGAGSFCGRSLSAKRTTTIGYERRFNQILQIHDKEAFINELTKNMPPSPDHFSRCSDENRR
    GPALLSTLPPVRGISPRAGKDLMTQGACEVLDSRRYDAFGSLHIPKSWNIDGEMNFSTFTGWVIPPDRDILLAVHRPDEI
    PKITLMLHRVGIDRIIGYVEGGVWGWALAGHELDHVQTISVQELAALLKADKELIVLDVRTGAEFAGYHIPGSVNIHWPD
    LRTRYSELSREKRIAVL
    CATGARSSMACSILKRNGFSNILNVAGGYTGWVAGGFQ

    >gi|88603734|ref|YP_503912.1| thioredoxin [Methanospirillum hungatei JF-1]
    MRIFKPTPSQSSPMDEELERLRAKRMEEIKQRIMTPPSAHEGILIVTQENFSRIIRENPNLIIDFWAPWCGPCRMLAPVI
    EQLAAEYAGRIRFAKCNTDENQQIAYQFGISAIPSLFFFQNGTIIHTVSGALPKEHLEMQIRSVYTIQAPHRSD

    >gi|88603835|ref|YP_504013.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methanospirillum hungatei JF-1]
    MSSMTEKEMNTGDPAPDFSLPDHTGTMHTAASYRGSWYILYFYPKDNTTACTAEALAFSAVYEELAELEIPVIGVSPDTM
    ESHRKFIEKHDLMITLLADVNHEVIGAYGAWKRKKMYGKEYMGVERSTFLIDPNGIIREIWRNVKVKGHVEAVTSRLREL
    KAVIP

    >gi|88603873|ref|YP_504051.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanospirillum hungatei JF-1]
    MRLARAGKKVQLIEKRSAGVGGQCLHQGCMIICALNDVARFMQQARVFQKYGFLGSAEGFSYPVLIRKMQEIIKIIAGVL
    EEETIHAGVEIIRGSAEIQGRTLLINGVETPCEAVIVASGAHPRIPEISGCCLPGVYTAHTILSMPSLPKRMVIIGSGVI
    AAEFAYIFSSFGTEVTILARSSLLRAFPEQLIKEARKDLSQVTIEEQVTIAGITGQESVTGVIIRENDGMREIAADAVLL
    AAGMIPNTDFISDIACGPDGALLVNDRMETSVPGIYAAGDVTGTGYLTPIARHQGRKAADAILKNPFEPDPVAIPQAIKL
    KHDVAYCRRPGEVRKGLTIPGPAGPGTFWEVTNHHTGSATIEFDENGHLTGLAEASPVASVAMAYLGWMMNSDIRIDEFD
    RFIEVHPSPDGIPWLLKYLNGKKSDNQKGS

    >gi|88603970|ref|YP_504148.1| peroxidase [Methanospirillum hungatei JF-1]
    MCYEEECECDGVGFPILGEPAPDFEAVTTHGKLKLSDLKGKWVVLFSHPADFTPVCTTEFIAFSQAEAEFKALNVQLIGL
    SIDSVHSHLAWVMNVKEKMGVEIPFPIIADLDMNVASKYGMIHPGQSSTAAVRAVFFIDDKGILRAMIYYPLSNGRYIPE
    IIRLVKALQTTDKAGVATPANWQPGEKVVVPAPATMEDAKVRLSQGYECKDWYLCFKNL

    >gi|88604045|ref|YP_504223.1| glutaredoxin-like protein [Methanospirillum hungatei JF-1]
    MGAVFIVYTLEFCPRCEILKDFLTSHQIPFTVADMSSAKALTELRVNGIFVQEAPVLQVDKTFLTSQELFSGDAINEQRI
    LQLC

    >gi|88604193|ref|YP_504371.1| methionine sulfoxide reductase B [Methanospirillum hungatei JF-1]
    MPSSDLIPIYHADTGTVRELKKVIRTDEEWSQILDKPVFDVARKGGTEPAFTGAFYATKIAGLYRCACCGTDLFSSVDKF
    DSGTGWPSFSGPVSAMNIRTRKDSGYGMERTEVLCGLCDAHLGHVFDDGPPPTGMRY
    CINSASLIFFPGIITIRQE

    >gi|88604224|ref|YP_504402.1| hypothetical protein Mhun_2996 [Methanospirillum hungatei JF-1]
    MTHSPNRLVKEHSPYLRHHAHNPVDWYPWGDEAFARALENDMPVFVSIGYAACHWCHVMETVCFEDEVVASLLNTHFVSV
    KVDREERPDIDQVYMAVCQAMTGSGGWPLHVFLTPDKRPFYAATFIPKMSSPNMPGMLDLLPYLASVWRDEREKVSDLSD
    QIMSAIQEQTRRGTLHDPDELIHTAARRLTALYDKKYGGFSPAPKFPSVPVLLFLLRYAVIHQDRSILDMITTTLNRMAW
    GGMRDHLDGGFHRYATDTAWKLPHFEKMLYDQAMCAIIYTEIWQVTKQDRYRRLARSVLEYMTTVLSDAPGGFSSSEDAD
    SPGGEGAYYLWSYDEIEKIFGEEARLVCTMFGITREGNVSGMHGMKPGDNVLFPERDPLEILSAAGVRDPEKTYASILNT
    LTNARKERERPPLDDKVLTDWNALAIQALAFAGMVFHDESLCTRAISAAEFLFSNMVRPDGSVLHRWRNGQGGIEGTAGD
    YVHLAWACVTLYQTTGNSLWLRRAISLEKSASDRFYDSVHGGYFQVPSETDLPVRMKEMTDGPTFSTNGAAYLLLCALFT
    ITGDELYGQKSRQIEEYQRSLDPRMITGCCTFLCGLIEKNLRGTAVLCNTSGSTGDDEIWSLLWSSYLPGMIRIHIRERS
    DSYFLPLYVHCQGDTPALHICSHQQCYPPITTVGELRRYLRGLHIFQGDEISDTIQAPDK

    >gi|88604277|ref|YP_504455.1| glutaredoxin [Methanospirillum hungatei JF-1]
    MTDTYLSHMPEVTVYSTQNCPYCRLAKAFLDRNNIPYRSVDVGIDRKAAKEMVELSGQYGVPVIVAGEEVIVGFDTDKLR
    ALFTTGKKPDMFDVIIVGAGPAGLTAALYCVRKNLKTLMISPDIGGQALESWNIENYMGYRMITGDDLMAKFEEQIRELE
    IRIELDQVNSLLPTSGGFSVKTVSDQEYKGKTIILSQGKKPRKLGVAREEEFIGRGLSV
    CATCDGPIFKEKVVGVVGGGN
    SALTTALEMSGIAKEVHLIVRSSIRADAVYTSQYAQKQNIITHTGYEVTELIGDDRLSGIIITNRETGEKKTLKLDGLFT
    EIGWIPNTSFVEGLLKLNDQKEIVIDINCRTSAPGIFAAGDVTSIAGKQIIIACGEGAKAALSAFDYLMTQ

    >gi|88604398|ref|YP_504576.1| thioredoxin-related [Methanospirillum hungatei JF-1]
    MSKPILMDFYAEWCGPCKRMGPILEELKNRMGDLVEIRKINVDEHMAEAQNYHISVVPTIIIEKDGIVVQKFQGVTEADT
    LESVLRPLVA

    >gi|88602149|ref|YP_502327.1| hypothetical protein Mhun_0856 [Methanospirillum hungatei JF-1]
    MHMEKIERGMYSLILLVNLVILMLIPACSGAIFQKDGTEITRDEVTKIFTHNSIFHENSPIQIQFFYSSGCGSCKDVLQF
    LQSYERKNPSVLIEFRNLVYDEENRQLFTEYKNQFNYSKISYPALFIGDIGITGSSDIIHITDSVVKGYQNL