Methanosphaerula palustris E1 9c uid59193

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|219850803|ref|YP_002465235.1| heavy metal translocating P-type ATPase [Methanosphaerula palustris E1-9c]
    MEETEKAELQISGIHCATCAVTIEEALAAVPGVEKAEVNIATNTATVHYDQGKTGLAALEGAVTDAGYEVVRAEAVIRIG
    GMM
    CAVCVQTIEAALLDLPGVSTATVNLASEKAYVTYNPSLTSVAVMREAIEGAGYTFLGLDREVTDEAVDAALKKDLWD
    KVKRFSVGFVVAGILMAIMFLFPMLPYMGLVMLVISLPAFVYVTAPIFSAAATALKHGALTMDVMYAMGTGVAMGASILG
    TFSIVLTPEFMFYDTALMLGAFLMLGRFLEGRAKGATSQAIRALIALQPETATVVREDGPAEILLSEVVVGDLLMVRPGG
    RVPVDGTVTEGESSVDESMITGEPIPVHKLPGDQVVGGTLNATGALTFRAEKVGSETMLARIVQMVSEAQGSKPPVQQIA
    DRVVAWFIPAVLAVAVLAFLVWFLLLHAPLVFALSTLIAVLVVACPCALGLATPTAVTVGLGRGAAIGVLVRNGDALEAA
    EKVTTVVFDKTGTLTVGRPEVTAVIATAGDAARESLLAMAAAVELNSQHPLAGAVIRAAEKAGAPLPKSTGFTSSSGRGA
    SALIDGRTVLVGSGGYLDELGVEADLALVAQAASHQQAGETVVMVAVDGQMAGLIAIADVLKPSAPPAVAALKKSGRRVV
    MLTGDARVTAEAVAGRAGIDLVIAGVLPDQKAAEVKRLQQQGEVVAFVGDGINDAPALAQADVGIAIGSGTDVAVETGSI
    VLMHEDLLGVVAALQLSAKVMQRIRQNIFWAFAYNGLLIPLAAGVLYPFTGFLMRPEYGALAMALSSVTVISLSLLLRTY
    TPPAVRQRGTGSALSA

    >gi|219850890|ref|YP_002465322.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methanosphaerula palustris E1-9c]
    MAEMIRIGEQGPELSIKDQHGDEFHLSDAAGKRVLLSFHPLAWTPPCAAQMSALEAHLDDLRSLDTIAVGISIDSVQSKI
    AWARSLGIRDTRLLADFWPHGEVATRYGLFREKNGFSERANIVLDEDRTVIFAKIYPIHDVPDIEEVLRFIGHEAPRTGE
    FTEI

    >gi|219850923|ref|YP_002465355.1| alkylhydroperoxidase like protein, AhpD family [Methanosphaerula palustris E1-9c]
    MAKDTFEELLQGIANNGVDQTCVNWMKDIEQEYGKVPLIFRRMAERPEVLISHLLYKGTVAETSTLDPKYVELICLAVGA
    ALKCTH
    CTGYHMQAALKMGASREEILEVILLAGLISNSSVLANAYRVIDDKLERCIPCDNKGVTCPRSSE

    >gi|219850980|ref|YP_002465412.1| Peroxiredoxin [Methanosphaerula palustris E1-9c]
    MELEDACGCGCEDEYAAMPILGEPAPDFTALTTQGELKLSDLKGKWVVLFSHPADFTPVCTTEFMGFAAVADELKALNVQ
    LIGLSIDSVSAHLAWIHAIEEKMGVEIPFPVIADLDMRIASRYGMIHPAMSNTATVRSVFFIDDKGILRAMIYYPQTNGR
    YIPEIIRLVKALQTTDAHGVSTPVNWQPGEKVVVAPPKTVAQMKARAGEGYECKDWYLCYKSV

    >gi|219851071|ref|YP_002465503.1| glutaredoxin [Methanosphaerula palustris E1-9c]
    MGTVRVYFTDNCPYCKMVKAFLDKKHVAYQAINVGQDREAAAEMVKISGQYGVPVLTVDDKVVIGFDTPRLEELFGAEKR
    ADAVDVLIIGAGPAGLTAGVYCARKLLSTVLITENIGGQAMESWAIENYMGYRMISGNDLMQKFEEQVRQQSLRLDLDRV
    ETLVSEGDHFLATTATGGTIQAKAVIVASGMHPRPLGVEGEDRYLGRGLSV
    CTTCDGPLFKDKKIAIVGGGNAAVQTAIE
    MSRIASSVSLIVRADLKADPTYIKKLETISNITVHLYHQITQLHGDLFLDQITITDSKTGKETTILLDGVFAEIGWLPNT
    GFLSDLLTLTGDGKIVVDENCHTNRAGVFAAGDVTSIKGNQIIIAAGEGAKAALEAYRYLTRL

    >gi|219851165|ref|YP_002465597.1| glutaredoxin [Methanosphaerula palustris E1-9c]
    MQIEVVDGRDKGNVMLYALSTCGWCAKTKELLKSLGVKYSYLYVDKVGPDEQEQVVKEIERFNPHLSFPTLVIGNDHVIV
    GFREDEIRKELA

    >gi|219851250|ref|YP_002465682.1| thioredoxin [Methanosphaerula palustris E1-9c]
    MDDELQHLREERIKEIMQQRAHVLEPVLEPVLVSVLPITVMNMEQTLTSHPLLVMDCWAPWCGPCRRVGPIIESLAREMA
    PTVTFAKCNTDENHQISARFQISAIPTILLFSSGKLVGRITGAYPQEVLRSKIVRTFGLRH

    >gi|219851317|ref|YP_002465749.1| copper-translocating P-type ATPase [Methanosphaerula palustris E1-9c]
    MMKKVEINIDGMHCGSCATLISRALTKTPGIVTANVNYASRKARVEFDESLLDEQRLIDLIVSKGYGAKIGVDPDTERLV
    REKEISDLKISLIFSALFAVPALLLGMVFMDVPYRVLLLFLLATPVQFVVGKNFYLGAWSALKNRIGTMDTLITVGTSAA
    YFYSVAAMFGLVTEQYFETAAVLITLVVLGKYLEAVTKGRTSDAIRKLMGLTPKVATIVREGREIEIPIEEVMVGDLLLV
    KPGERVPVDGTVVEGGSAVDESMITGESIPVEKTVGSTVIGGTINKNGMIRFEATRVGTDTVLSQIVRLVEDAQGSKADI
    QRFADRISGIFVPAVIGISVLTFVAWYFVFGMSFPFALMVAVAVLVVACPCALGLATPTSIMVGTGVGAQKGILIKSAES
    LEMMHAVNAVVFDKTGTITEGKPRVTNFLTESEDEVPTLIGYAYAVERNSEHPLADAVTEYGRERGVNPGDVSEFRAIPG
    FGVAATVDGRSVYLGKPEPGVLGADMETKVSRLQSEGKTAMILKVDNVPRAVIGVADTIKATSARAVEDLKRLGIETWMI
    TGDNEKTARAIARIAGIENVFAGVLPQDKAEYVKRLQEKGLKVVMVGDGINDAPALAQADIGIAMGSGTDVAMEAGSVVL
    MRSDPLDVPQAIRLGRATIKKIRQNMAWALMYNIIGIPIAAGILYPSYGILLSPIIAGGAMALSSVSVVTNALTLRWVKL
    QVTP

    >gi|219851318|ref|YP_002465750.1| Heavy metal transport/detoxification protein [Methanosphaerula palustris E1-9c]
    MIVSDLTLHGMHCESCARIIERTVSRHAGARVTSVDMANNRLIIESRRGHLEEIRDELRGKGYQLLLPGERAAEGFEAGS
    FRRGIDVLKKVIFNARGFEVEHTLFRYALGAIALVLVVQAVLFGVLFKNTPGYLNTYWSVMLLTTVSVVAFLFAYYHSNA
    FRKSSSCMTGMMTGMTFGMAGGFLIGAFVGATNGMFLGSIIGMGAGMSLGYVTGRSCGVMGVMEGMMGGLMAGTMGAMLS
    AMLIYDRLVPFLFILVGTEGVILVAFSYMLYKEFGNMTKQDLRVSGMEFAVLALALNLALTVVYVFGPKTGYVLGG

    >gi|219851319|ref|YP_002465751.1| heavy metal-binding domain-containing protein [Methanosphaerula palustris E1-9c]
    METTLKVYGMHCASCAMLIEDAISEIPGAQVLSVDHVSGTVVVTHDSEATLEAIGQAIQSEGFTL

    >gi|219851325|ref|YP_002465757.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Methanosphaerula palustris E1-9c]
    MTEENDAKGSKHYDLMVIGTGEAGPTIARRCRREGWSVAITDERSYGGTCGQRGCVPKKVLNGVAETVDRARRLKGDGIG
    GECHIEWADLIQFKRRFTGPVEARRTATLAKDGIVCLHGQARFTGRNELKVGDERVTARFIGIATGAVPLKLSIPGEELV
    ATSDDFLAMESLPKRILFIGGGLISFEFGFIAAAAGASVTILHRSERLLKGFDPFLVGLLVESCREMGICIETDMPVSAV
    EQAGGHLRVLSRDRIFEADMIVHGAGRVPNTAGLDLARGGVTTDRKGIVVNPYLQSVSNPSVYVAGDANPRGRPLSPVAS
    RDGKSVAENILHGNTVVPDYSAVPTAVFTAPVLAAVGLGEEEATMRDIPVTVYRADTRDWYTTRRLELGRSGYTVLTDSP
    KGRILGAHLLGYNADEMINVFALAIRRGLTLADLQEMDWAYPTAIHDINRIR

    >gi|219851440|ref|YP_002465872.1| Rhodanese domain protein [Methanosphaerula palustris E1-9c]
    MKTRPALSMILVLVLIGVVVALAGCTALQGTTSQDANSSQNSTIRDITPQEASALIQQNSNSDQLVILDVRTQAEFQAEH
    ISGAINRDVTAGVFRDQMKSKGMDMSKTYLVY
    CQSGTRSTTAAKIMQDLGYTQIYNMKGGIGKWKDAGYPTVVG

    >gi|219851663|ref|YP_002466095.1| Thioredoxin domain protein [Methanosphaerula palustris E1-9c]
    MSKPVLIDFYAEWCGPCKMQSPLIDRLKEKMGDAIEVRKMDVDQHMKEAGEYQISVVPTLIIEMDGKVVKRLEGVTSAED
    LEQMLRPLVTD

    >gi|219851775|ref|YP_002466207.1| UBA/THIF-type NAD/FAD binding protein [Methanosphaerula palustris E1-9c]
    MKDEQIERYSRNIILKEVGGKGQERLLQSKVLIIGAGGLGSPAALYLAAAGVGTIGIVDGDRVDLSNLQRQVIHFTADVG
    TYKADSARDKITQLNPDVTVQIHKEMVSSSNIREIITDYDFIIDGTDNFPAKFLINDACILLGKPFSHAGILRFNGQTTT
    VIPDKSACYRCIFNTPPPVGTVPS
    CSESGVIGSMAGVIGTLQAMEAIKYLLGIGDLLTNRLLVFEALPMNFREIKIKKNP
    KCPVCGEHPTITSLIDYEQKVCELRK

    >gi|219851834|ref|YP_002466266.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanosphaerula palustris E1-9c]
    MITVVGGGPAGRIAAMHLASAGEEVRLIERDQLGGQCLHSGCMLVCALNDVARIIRSAKGLEEMGVIMNAPRVQIPGIFE
    GVVQVQRTIEQVLDNETATAGVTVLKGEVTAIDGLQVTLEGTVLDSDAVIIATGSRPLIPDIEGITTPGVYTPQTLVQME
    TVPEKLVILGGGISSVEMAYIFAAFGSEVHLCARSTLLKTLHPHLVAEARKELAGVHIHEQTAVISVNGGDRVRSVTVKA
    GSDEYDIAADAVLITAGLVPNTGMVTGVLKRADGAIIVDDHMRTSNPSVYACGDVNGRLNLTPVARREGIVAAENILGKD
    TTMDYRTIPHSLALGYELAWVGEPEEGQQRFRIPGPAGPGSFWSVPRQGATGFAEVQVRPDDGAITGIWTAAPSGAAIAA
    YSAQLIRDGQKVADFEQFIEVHPVADGVYGLLKYAAVQRSRR

    >gi|219851938|ref|YP_002466370.1| UBA/THIF-type NAD/FAD binding protein [Methanosphaerula palustris E1-9c]
    MLIFDEDGQERLKQATIVIAGAGGLGSPVAVYCAAAGIGRIVLIDKDTVDLSNLNRQILHSTPDIGRRKVISAEEKLQAL
    NPDIEVVAIHETIDAGNIGDLVGDADGIVDAMDNYPIRFLLNQTALSKGIPLFHGAIRGFHGQATTIVPGETP
    CLSCIFP
    HAPPKEVFPVVGVTPGIIGMIQAGEVIKYLTGTGTLLAGRLLLWDGLNSRTEEITVAANPHCEVCGSPQKE

    >gi|219852232|ref|YP_002466664.1| protein of unknown function DUF395 YeeE/YedE [Methanosphaerula palustris E1-9c]
    MFEFLTEPVWSPYIAGGGIGLLTCLVFLLSNRPLGCSTAFVKARGLIGMAFDAKKTEAMEYYQEIVPAVDWSLMIIPGVI
    IGAFISAILSGKFHLFWVPDLWGRTFGYSPVIRIVIALAGGILLGLGARWAGG
    CTCGHGISGSIQLSLASMIAAGCFFAG
    GIGVAVLIFRVVAGV

    >gi|219852274|ref|YP_002466706.1| DsrE family protein [Methanosphaerula palustris E1-9c]
    MTSKILYVQTSGPETPERLYSPFILGSTARSMEVEASIFFMIKGILVMKKGEAAKIQIGSFPRLDQVIEQAAAAGVHFYV
    CEQSTQLLGIPRGEFIEQATIGGAATLNDLALDADAVLTF

    >gi|219852297|ref|YP_002466729.1| methylated-DNA/protein-cysteine methyltransferase [Methanosphaerula palustris E1-9c]
    MALKEGVDRFQDWSVHVVWEEGSVYRIWFSDEEPSGEIPPLLSRYLHGESVDLNPLSVPGTDGDSLNARIYRAVRQVPYG
    STATYGSIAYSVGTGPRVVGQAMKQNRTPLLIP
    CHRIVAAHGPGGYTPDISIKLALLAMEQRLSCREV

    >gi|219852414|ref|YP_002466846.1| methionine sulfoxide reductase B [Methanosphaerula palustris E1-9c]
    MEQTADGTHSVPIFSVATGRIDMVEMVVHTDAEWQRLLTEDQFRVARKKGTEPAGTGIYAHCEAKGIYTCVCCGTDLFSS
    AKKFESGTGWPSFSAPVAETNVHRVQDTSFGMNRTEVLCSRCNAHLGHVFDDGPAPTHQRY
    CMNSASLRLVRDD

    >gi|219852488|ref|YP_002466920.1| beta-lactamase domain protein [Methanosphaerula palustris E1-9c]
    MILKKFRAEGLSHNSYLIGSGQQAAVIDPRRDCEAYITAAEAHDLKITDIFETHRNEDYLVGSVELANQIGATIHHGEDL
    DFQYGMPVKDGEVFSIGSLSLTVQKTPGHTPESISIVVTDRAVSDQAYLVFTGDLLFAGSVGRIDLTGDPAGAAALMYQS
    LHERLLPLGDGLIVCPAHGAGSVCGGHISDHPFTTIGYEKNTNPFLGLEREQFIARRVQEKTYVPPYFSMMERLNRYGPP
    LLPAGQSPAPLTPAEVKTCQDLGAQILDIRSPTGFAAGHIHGSLNIWREGIAAYAGWMLNYINPIILVDDFNLDRNSVVR
    TLQRLGYDRVTWYLAGGFTTWSTSGNPIAQIKTWGPEDLADHLDDPDLLILDVRDINNRIEVGWIEGSRHRYIGELPMHL
    DDLPLDRLIVIH
    CDVGYKGSLGASILAAHGYPRVVNLLGGIGGWINAGYPVKR

    >gi|219852529|ref|YP_002466961.1| Thioredoxin domain protein [Methanosphaerula palustris E1-9c]
    MDDGDLVRSGEQKDLLVSVNDQTFTQLIEMHDGPTFVIFQSATCQHCRTITPYIREYAGEFSDRVLFATIEVGQNPRVVE
    RFGIRSTPTFKFFCKGKPVKELVGAVYPAIIKRQIEEFLLYGNECATNSTEIDYEISGYA

    >gi|219852535|ref|YP_002466967.1| UBA/THIF-type NAD/FAD binding protein [Methanosphaerula palustris E1-9c]
    MTLTEKDETGSVLDSQNSTKNRYCRQIILPEIGTEGQRRFKESRAVIVGLGATGSSVANSLVRAGIGQVVLIDRDLVELH
    NLQRQILYSEEDLNRPKAVAAAEILRKINSSIEIEAHVTDFNISNAEKLLSGANVVLDGTDNLQTRFLINDICVKHSIPW
    IYAGVVGTGGMVMPILPGKTPCFRCLVPSLPGPGLLQT
    CDIAGVLNTMPPLIASIECTLAYQILTGQFDPKDEISYMVYI
    DGWRNTFDRVAVGRQPDCPCCVQGQRDFLDAVSREMVTSLCGRDAIQIIPSSQMEITLEDLEIRLSRLGEVRLHPYMLTF
    RTGTEEISIFRDGRAIIKGTKDEAMARSVYARYIGL

    >gi|219852706|ref|YP_002467138.1| Rhodanese domain protein [Methanosphaerula palustris E1-9c]
    MEEIDQSGETGGELSPEKCRTLIQNKGDRCTIIDVRTRDEYDEGHLQGAINMDLLNGELSAGVNTLKKNIPYVVYCRRGN
    RGKKAMDLLQSAGFSEVYNISGGYEQWKAAGLPTIL

    >gi|219852761|ref|YP_002467193.1| protein of unknown function DUF255 [Methanosphaerula palustris E1-9c]
    MHTTNSYSPSANQGDMTTPPEHQAAPPNRLIDQKSPYLLAHAHQPVAWFPWGEEAFARAAAEQKPVFLSIGYATCHWCHV
    MAEESFMDLKVAALLNDYYIAIKVDREERPDIDQVYMAVCQMMTGSGGWPLTIIMTPDRRPFFAATYIPKMSRFRGTGML
    DLLPMVAQVWREKPGDLIEVATQVVEALHQPARAGAGPEPTIDLLIAGYRGLAATFDPVRGGFGDAPKFPAPHNLLFLLR
    YWRRSGEPVALAMVEQTLQAMRHGGIYDHLAGGFHRYSTDGGWKVPHFEKMLYDQAMLVMAYTEAFLATGNREYRKTAEA
    TIQYVLRDLVTREGGFAAAQDADSEGEEGRYYLWTLAEVRGLLTQDEAATFTTAYQMTERGNFTDPSNPKLTGRNVLYRS
    PDAPLQDPDLHLVAADAKLAAARRERVPPLTDDKVLTGWNGLMIAALARAGRAFGVADYIDVAGRAADFLLGTMRDQGGR
    LLHRYRDGEVAISGQAEDYAALIWGLLDLYQATFTVRYLADAVEVMKEFTARCWDPAGGGFFSAAEDATDLIVRQKEQYD
    GAMPSANSVAFMDLLLLARLTGEPAYEEQAEELGRFMTGVVEQSPLIATFFLAGLDFALGPAQEVVIVGDEGAVDTTAMV
    RALAERFLPSTTVQFKPAAAGAEDLTTVAPFTASMERKDGRATVYVCSGQSCAPPAVGVEAMLEVIEGGGRIIF

    >gi|219852823|ref|YP_002467255.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanosphaerula palustris E1-9c]
    MVEDKKNQEPRIGVFLCHCGTNIAGSLSIDDVQAYAQTLPHVAHVDNYQYMCSTPGQSKIKDAIKEYNLTGIVVAACTPR
    LHEPTFRIATKEGGLNPFRFEMANIRDQNSWVHMHDHEGATEKAKDQVRIAVAKAALLEDLYPKSVPVEKAAMVVGGGVA
    GMQAALDLAAAGIKTYLVEKEPSIGGRMSQLDKTFPTLDCSQ
    CILSPKMVDVGRAENIDLYTCAEIEEVEGYIGNFDVTI
    RRKARGVLTPKEAEAKGIVGGGCTGCGDCTSVCPVVKPNVFEMGMAPRKAIYINHPQVVPLIYKIDFDSCVKCGLCVEAC
    GTKQAVDLEMQDELVKVKVGTVILALGYELFPIEKKEEWGYRRYDNVITGLEFERLICASGPTGGHLIRPSDGKTPMKVG
    FVLCAGSRDNTGVGKPYCSRFCCMYSLKHAHQITEKIPGAIPYIFYMDIRSFGKMYEEFYYRIQNEGAKFIRGRVANIQE
    DPLTKNLHVFAEDTLLGEPMDMEVDLVVLASAVQPTDMTEKTRRLFGVSCSQDGWLLEAHPKLNPCGTTTAGVFLAGVCQ
    GPKDIPDTVASAEGAASAASIPIHMGQVELEPYFAMCIEEKCAGCGMCVNLCPYSALALVEKDGRTVMQVTEAKCKGCGT
    CGGFCPGGAIWMNHFTSPQILSQIDSFLVGGEQ

    >gi|219852856|ref|YP_002467288.1| peptide methionine sulfoxide reductase [Methanosphaerula palustris E1-9c]
    MVSRAEEDRIETATFGGGCFWGVEEAFRTIRGVTKTTAGYMGGTTPDPTYEMVCTGRTGHAEVVQVEFDPNLIEYQALLA
    IFFSHHDPTSLNRQGPDVGEQYRSVIFFHTPVQEEEARRMIQDLDQSERFRGPIQTAVVHASRFYPAEKYHQQYLVKHGR
    SGCHL

    >gi|219853104|ref|YP_002467536.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanosphaerula palustris E1-9c]
    MREVAVIGAGVAGIQAALDIANHQVHVHLIEREPSIGGHMAQLDKTFPTNDCSMCILSPKMVEVGRHPWITLHTCTEVTA
    IEGEVGDFSVTLQTNPRFIDPDLCNGCGDCEEVCPVEVYNRFDAGIGVRKAIYKPHAQVVPNIMIKDPDHCIECGLCYDI
    CGRNAVLREQSPVETTVHVASVVITTGYQVFDPTKKPQYGYGLVPDVITSLELERMINAGGPTSGEVRRVSDGQSPRSIV
    FIQCVGSRDLQVNRPYCSCVCCMAAIKNSLLIREKHPEIEVAICYMDIRAYGKGYQEFYQRAQDLGVRFVRGMPGAVIDS
    TGPMELQVEDTLSGELLQLHPDLVVLSVGMEPASDPAVVAARFGLTCEESGFLEGAHAAMNTVGTIRPGIYIAGTATAPK
    DIPDCVTQGQAAAMRAYTDAIRVN

    >gi|219853128|ref|YP_002467560.1| redox-active disulfide protein 2 [Methanosphaerula palustris E1-9c]
    MTTIEVIGTGCAKCHQLEKNVLETVKELGLTAEVVKVSDIAEIMKRGVIFTPALMVDGELKVSGRVPSVKELSGMLTKGK


    >gi|219850697|ref|YP_002465129.1| glutaredoxin [Methanosphaerula palustris E1-9c]
    MSPAPKLTVYTLEFCPNCEILKEYLKGHGVAYTEEDMSTAASLTELRLNGIFVNEAPVLQRGMAFLTSADLFTGGAVNEK
    NVGPFIKGDQM