Methanosphaera stadtmanae DSM 3091 uid58407

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|84488933|ref|YP_447165.1| putative thioredoxin [Methanosphaera stadtmanae DSM 3091]
    MTIKLEVFTSLSCPYCPMAVAAAEEAVKELGDVVDYEHLDVNENMDKVQEYTIMSVPTVVIDGEVAFIGAPSTEELVEKL
    KEKL

    >gi|84488956|ref|YP_447188.1| HdrA2 [Methanosphaera stadtmanae DSM 3091]
    MTNQHKIGVFLCHCGGNISDVLKLDKIEKQLIKNNEVVSIKHHENLCSLEGRKIIKDQILRENLDRVVIAACSRVTHGET
    FQNYIKPLNPYLFEMPNVREQCSWVTKNHEEATNKALSLINSAIESVKYDEPLEKIPTQVKNSVLVIGAGISGITTAVSL
    AKQGMKVTLIEKRPAVGGAMVQVGKVFSPEKLTEDCAA
    CLLNPVIDEMVHNKNIRLLTNTKLERSERRAGNFDVILRKKP
    VYVDTQKCTSCGRCTSACPTVVPDEWNEGLINRKAIYKPFPQAVPSTYTLDDEHCIKCGICTNVCPTNAIDLDAIDDIIS
    LTVGSVVIATGHQRFDTSKRPEYGHELYEDVLSQMELARVMGVNGPTHGKLLVPSTGKVPRRVVMIQCVGSRDQLPGGHK
    YCSKVCCMVALKSANLIRTHYPDTEVIICYTDIRTPGVYEKYYKYGQDNGIELIRGRPGEIAREDDHMIVRIEDTLTGIR
    EEIPTDLIVLSAALESSKGTIEVAKTLNVALTEDNFIKEKHPKMKPVTTDIEGIFVCGTAQGPKDITDSIIQANAAATKI
    SELVNGGLEVEPFIASINVKKCVLCGSCVENCVYQAITLNRNSIHVDAISCTGCGDCIITCPQEAISIQGQSDDKLEASI
    RGILKNKKDDERIIIAFLDDIGNVSANNMGINRVSCPSSVRIINVPFINRVKYRHVLYALTHGADGVFIGEYPDTPKHKE
    IRENVNIMKKHLEEEGINPNRLIIHSVFIPYFRGLANQFKEFDEELRLNSY

    >gi|84489052|ref|YP_447284.1| cation transport ATPase [Methanosphaera stadtmanae DSM 3091]
    MTKEDVFKVEDMACNACVNTITKTLSNNENISNISCNLESKDVSVTYDEEKVDVEEIISALDNIGFSATIKKKTLNIGGM
    T
    CVMCSKAVTSTISKMPGVYSIHVNLISETAEVIFNPTVVTVKDIGDRINSIGYEYMGIHDNNSINNNIIEEKHNQNLRK
    KLHRIIVGFFFSAILMYLMFSNFNFNGNESYIQLAITILPFIYVCSPIIISGINSIKHHNLNMDVMYTLGIGISFIASLL
    STFGLLGESHFMLYDTSIMLGSFLMLGKYLEDRAKSKTSDSINKLVELKATEATIEKTINEKTITETVDINKVLKGNIVV
    IKPGEKIPLDGQIIEGKSYVDESLVTGESTPIEKNVGDVVIGGSINKDGTFKFKVTNTGDKTVLSQIISMVQDAQNSSPP
    IQKLADKVITYFIPGILTIAVICFIIWYVIYGSPLLYSLSIFISIVVVACPCALGLAIPTALTVGVGLAAKNGILIKDGQ
    TLEVSQQITHVLLDKTGTITVGQPVLSNIINYSTESDEEVLMIARSIEQYSQHPIAQALFNNQKKNEFELYDVDEFENIS
    GKGVQATINNRDYIIGNKKILNDNNVPIPENILKDFENEELNMKTSIILADNKNIIAILSVSDVIKENSKKAIDQLHKMN
    IKTTMISGDNKNTSSIVAKQVGISNVVSEVLPQEKLDYVKKLQSEGEIVAFIGDGINDAPSLTKSNVGIAIGTGTDVAIE
    SGDIILINGDLLNAVASIQISRKTMSRVRLNLFWAFAYNVVLIPIAAGALIPWNILFRPEYSALAMALSSVTVITLSLLL
    RSYVPEIFRE

    >gi|84489546|ref|YP_447778.1| putative peptide methionine sulfoxide reductase MsrA/MsrB [Methanosphaera stadtmanae DSM 3091]
    MIDNLNKKISYKKENLRTIYLAGGCFWGVEAYISRLLGVAKTTVGYANGNTENPTYDEVCLENTNHVECVKVDYDNNILP
    LKKLLEEFFKIINPLTINKQGNDVGVQYRTGIYYRNETDKRIIINFINRKQGEYSQKIVTEVLPLNNFYPAEKYHQKYLE
    KNPTGYCHIDLTQLPNQKKQLEELLIKEDIMNLTPIEFDVTQKNATEKPFSGKYNDFNKKGLYVDVVGGEPLFISDDKFD
    SKCGWPSFTKPVNDSHIQKLNDTSHGMKRIEVRSKKANSHLGHVFDDGPRGEKRY
    CINSASMKFIPYDKLEEMGYGRYVK
    YFK

    >gi|84489620|ref|YP_447852.1| putative thioredoxin [Methanosphaera stadtmanae DSM 3091]
    MVVLLEVFTSKNCPFCPKAIAAVEEAVKELGSQVEYKHYDVDEDVDKTMEYKIMSVPTIVVNGRVAFRDAPEPKRLISKI
    KRNMK

    >gi|84489871|ref|YP_448103.1| dihydrolipoamide dehydrogenase-related protein [Methanosphaera stadtmanae DSM 3091]
    MTRIVIIGAGPAGRFASMAAAEVGNEVTLIENKHIGGKCLNQACMVVCALNDVSKHVLDAENFNNQGIIDSTPTVNYKRV
    TTLIKETQKKIRKILTKETINTGVEYVQGRAEVDIENKMVIVNEDDEYPFDKLLVCTGSSPYIPDIPGVHNAYTYKDTLK
    INEVPEKLVIIGGGSTAAEYANIFSSLGSQVEILCRTQFLKMLNDSEAEEYIVSKLLKNTIIHENVEIQEITDTSVVTNF
    GEIEGTVLLATGVVANSEIVKDIVELDSDGNILVDEFMQTSHEDIYAAGDVIGGILSTPVSRMEGICAIKNIMGKKVKPD
    YSLIPLTISLSYDVSYMLGNQVSSIGKEVTLPGAAGPGSFWNTLNGKTGFTKEVVNNDGDITNILAITPSSNVALPYMIK
    LIKSGSKVSDFEDFIEIHPTTDGIFKLTEYFKRYL

    >gi|84490195|ref|YP_448427.1| thioredoxin reductase [Methanosphaera stadtmanae DSM 3091]
    MYDLVIIGAGPAGLTAGIYAGRSGLNTIILDENQSGGTVNVAPLIENYPGINEIPGVDLARSMTEQAKKYVDIREFSLVE
    SISKSIGGTFEIKTTNDIIDTRYILIATGSSYKTLDCVGVDEFVGRGVSY
    CAVCDGTFFVKKEVLVIGGGNSAVTEALYL
    NRIGVKCSLVHRRDKLRCDSQLEKDLHNANIKIYWNTQLKSVNGNDFLEEAVLYNNETGDETKVKVSGIFIAIGYTPNNK
    LIKDFGISCDDLGYIEVDENMKTSVDGIYAAGDITGGVKQVIVAAGQAAQAVTHISELLLI

    >gi|84490241|ref|YP_448473.1| NAD(FAD)-dependent dehydrogenase [Methanosphaera stadtmanae DSM 3091]
    MNIVVIGGGASGLTTASNIRKYNKDVQIIVFTTQKNVAYSPCAIPYVIGGHIDSFDDIIMHKPEEYMSKDIRIMTESRVT
    EIDHDNTEITYEDKDGNKQNIKYDKLVIATGGKPLMPPIPGKDLEGVFKVRTIEDGEEILAYSEKSKNVVLVGGGAIGLE
    LGSELAHKGLNVTIAEMMPQLFPRSFDKEMSDKFQEHLQGKNIKILTGSAVESINGETKVESVTIDGEVQPADMVILSTG
    VRPQTELAESIGCELGKFAIKVNSHMETSVENVYAVGDCVEVIDAITGQITLSPLGTTAVRQGIILAKHLTGHEIEFKPV
    LNSTVSQIGIMEMGAVGITQQSAQKEGIDVVVSNIDTLSRARYYPGSKPLHIKLISKLDGTIIGCQMFGQEAVAERVDTM
    TAIMSQKLKCDEVVSMVIDPIAQAAANCLEQIEAIESEINSSCCEVKEESTDAEEDKPVDDTSENLSFTESLRAQGLIQK


    >gi|84490257|ref|YP_448489.1| HdrA1 [Methanosphaera stadtmanae DSM 3091]
    MANNEEVRIGVYTCHCGVNVGGVVDCKAVAEYVETLPDVVVSREYKYMCSDPGQNLIQDDIKELNLNRVVVAACSPRLHE
    PTFRRCVKEAGLNEFLFDFVNLREQDSWVHGDDPEGATEKAKDLVRMGVAKARLLNPLTAEKVSVEKTAMVIGGGVAGIQ
    TALDLGDMGFKTYLVERRPTLSGRMGQLDKTFPTLDCSM
    CILAPKMVDAGKHANIELLAYSEVRDVDGYIGNFKVTVERK
    ARFVDEVTCTGCGVCQEVCPIEMPNYFDEGTGMVKAAYIPFPQAVPLVATIDDDYCIGCKLCDKACEIGAIDHEQEPTTV
    ELDIGTIVVATGYDTFDPTEKEEYIFDQAENVITGLQIERYINASGPTQGHVIQPSSGETPKRIAFIQCVGSRDEKVGNP
    YCSRVCCMYAMKNAQLCVDHEPDTEVTIYYIDIRAFGKGYEEFYRLSQEKYGIRFIRGKAAQLIENEDKTITVRAEDTLL
    GKSTAYTYDLVVLSVGLVPPEGMDDLRQILGLSKSADGFFMEAHPKLRPVDTMTNGIFLAGVAQGPKDIPDTVAQASGAA
    ARAAIPMIQGEVEIEPITAEVSKDNCGGCEICVELCPFKALSIVDGKCEVNIALCKGCGTCVGACPTGALDQAHFRDEQI
    LAQIEAAFN

    >gi|84490279|ref|YP_448511.1| putative methylated-DNA--protein-cysteine methyltransferase [Methanosphaera stadtmanae DSM 3091]
    MNVFHRQEVLNLGSLKYMVFNSLIGEIAIVWDKNEIIKQVVLPDSKSRKHNYGDIQYHGVLHEVHPSKYILKIMSNIKEI
    IMGHDIKFELNQLDLNDLTQFQREVLLKQNEIPYGMVTTYKKLAQLIGRPKSARPVANTLASNPFPLIIP
    CHRTVKSDWT
    LGGYNGRKDGYFKRFILENEGIRFEDDVIKQQYRYPQEDVESMNKI