Methanosarcina mazei Go1 uid57893

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|21226158|ref|NP_632080.1| heterodisulfate reductase, subunit A [Methanosarcina mazei Go1]
    MRIGVYVCHCGLNIAGVIDVSALEEMAGELEDVVLAREVQFLCSDSGQEGIIKDIKDNKIDRVVIAACSPRLHEKTFRHV
    MEKADLNPYLMEMVNIREQCSWVHADDPQMATQKAFDLIRMGVAKARFLRELSATSSKASRNVLIIGGGVAGIEAALNLA
    EAGFPVTMVERESTIGGKMALMNEVFPTNDCSI
    CVLAPKMTEVQNHPNITLYTYSEVTDISGSVGKFHVRVTRKPRFVLE
    DKCKGCVDLCSEVCPVEIENPMNYGIGKSRAIYMPIPQSVPQVVLIDPDHCVGCGLCQLACPAEAVDYEQKPEEIEFEAG
    AVIVSTGYQLFDASRKKEYGFGKYPDVITNMQLERMLNSAGPTGGRVLVPSTGQPPESVAFIQCVGSRDKTVGNEHCSRV
    CCMAALKNSQMVKERYPGTDITIHYIDIRAAGEMYEEYYARTQGMGVDFIRGKVAEVYAGEDGRPVVRYENTLESRVEEE
    AHDLVVLSTGYEPSKAAEGIGRMLNLARRPDRFFASAHPKMRPVDAPVSGVFLAGCASGPKEIQVSIAQGSACASKVMQL
    LGTGELEADPMGAHVDPDKCIGCRTCVEVCKFGKISIVDKKAVVDEVSCYGCGDCSAACPVGAIQMRNFENEQILAQVRA
    ATAHKSQCPFVVAFLCNW
    CSYACADLTGMSRIHYPTNIRVIRTMCSARINPEFVLEALKGGADGVLVAGCRMDECHYIHG
    NFDAKKRMDVLKEIIKEIGLDPKRLRTLWISAAEGERFSNTITEFVKELEEIGPIGSELKREYTATGLEEVAK

    >gi|21226436|ref|NP_632358.1| hypothetical protein MM_0334 [Methanosarcina mazei Go1]
    MTKVEKVLLLLKNMVYESTSPQETLKFAKYYRSKGLDVLVILWGPMGVLLAKKDKTRGSPKYDASVQECIDMGVEFRCCQ
    LASDMIGLKKEELIPGIEFICSKEVAELFLTYSEENQLIINF

    >gi|21226452|ref|NP_632374.1| putative molybdopterin biosynthesis protein [Methanosarcina mazei Go1]
    MIIPGIAAAETCPDGYKNVSVCKAEKMVEKEDVFLLDVRTPAEFNKTHIEGTILIPVKNVPAQDPVELSSDELLEVRINE
    VPADEKILVY
    CKSGARSAAACSLLVSNGYRKVYNMRGGIDCWLARGCTVDVNADKADELLGTGEFFLLDVRTPAEFNAGY
    IEGAILIPLKNVPKEDPVELPPEKLLAQCLCEIPENKPILVY
    CKSGTRSDAARDLLVDSGYRHVYNLEGGILTWKAEGYP
    TVCPAI

    >gi|21226470|ref|NP_632392.1| hypothetical protein MM_0368 [Methanosarcina mazei Go1]
    MSEKLGFTPHILEILGCLDSDSLKKYNRCNKKLLSDGALPAKVKILIALAVVASKQCERCTVVQMQSALKNGATKEEIME
    VMDVIFITSGAPAVAACRDALKLLK

    >gi|21226489|ref|NP_632411.1| heterodisulfide reductase subunit HdrA [Methanosarcina mazei Go1]
    MTDGTTDGLNKAAVFICHCSGNISEHVDINTVKKTLKAEGFSVYDYEYLCSSQGQALIKKKISEGHVDRVVIGSCTPSKH
    GTLFKKCIQETGLNRAGLEIANLREQCAWVHPDREGATEKALSLLKAKLKRLENIEPLEDIKVDIAQQVLVIGGGIAGIT
    AALNLADNGVPTFLVEKDSSIGGQMAKIGKIFSPDKLAEECAM
    CSLSPLMNEVAAHPRITLLTWTEVEKLSGSAGNFTVR
    LKKKPRYVKDNCIACGKCSRVCPVSVEDEFNCGYMDKKAISLRFSQSVPKVYFIDPDSCLRLKGENCGKCAEACKTGAID
    FSQKEEIIELNVGAVVVATGFEEYDVSQKPQYGYGIFENVLTQMELARVLGINGPTKGELLRISDFSKASSDPAPSTCDS
    RCESSSDHPFEVETPERIVMIQCVGSRDEKEGGNRYCSRYCCMAALKHASLIKKRYPKTEITICYIDMRAFGFYENYYRA
    VQETGVNFVRGRPAEVIEKPDKSLVVRVEDTLSQKIKEIPADMVVLSAAMVPSPGTKKIASVLNLSQDESGFIKERHSKL
    KPVDCSLDGIFVCGTAQSPKDVTDTIAQAGLAAVRARAFITDSPKVLDNEIAAINQLLCTRCGECLKCPFDALSINENGR
    VVLDPLICTGCGYCTELCREGAVQIAGFTKSQLKAELEGVLEEGDVLGFVNSGISSLTCDNIGNSVLTYPSSVKLIKVPT
    CLIVDRDLVLHAFRHGASSVLFVEDPPDSPRAEVIYPLTVSHFEKLKEELGDSGKRIHFKKAYVPNIKGLAGTFTSLARE
    GEMIK

    >gi|21226538|ref|NP_632460.1| thioredoxin [Methanosarcina mazei Go1]
    MKPMLLDFSATWCGPCRMQKPILEELEKKYGDKVEFKVVDVDENQELASKYGIHAVPTLIIQKDGTEVKRFMGVTQGSVL
    AAELDKLL

    >gi|21226601|ref|NP_632523.1| hypothetical protein MM_0499 [Methanosarcina mazei Go1]
    MDAFVKDKMNQSMNDRKQYHSRFLENCSTYNSFLELEKKAFEAGSLSRKHKELMALSISIVTKCEPCIEWHVQQACLTGA
    SDKEIYETIDVALEMGGGPAAYSRFALNALDFYKKQA

    >gi|21226721|ref|NP_632643.1| hypothetical protein MM_0619 [Methanosarcina mazei Go1]
    MIILEKEQKEPNRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESFEDEEVAGLMN
    EAFVSIKVDREERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGTYIPKNTRFNQIGMLELVPRIKEIWEQQHEE
    VLDSAEKITSTIQEMIKESSGEGLGEEVIEEVYEELLSSFDTEYGGFSGAPKFPTPHKISFLLRYWRRSRNPEALHMAEY
    TLDKMRRGGIYDHLGSGFHRYSTDSMWLLPHFEKMLYDQALTAIAYTEAYQVTGKDLYKETAEGILDYVLRDLTSPEGGF
    YCGEDADVEREEGKYYLWTLEEIRSILDPEDSELIIKMFNLREEGNFEEEIRGRETGTNLFYMARSPGSLAAKMKIPVEE
    VEKKVKAAREKLLKARYERKRPSLDDKILTDWNGLMIAAFAKGYQVFGEQRYLKAAEKAADFILMALYSPGDGLLHRYRD
    GVAGISGTSDDYAFLIHGLLELYEAGFKMRYLKAAVSLNSELLECFWDPVNGGLYFTANDSEALIFRKKEFMDSAIPTGN
    SFEMLNLLRLSRIIADPGLEETADKLERAFSKQIMKAPSGYTQFLSAFDFRLGPSYEVIISGKAEASDTEQMLKELWSYF
    VPNKVLIFRPEREKPEITELAKYTEEQVPIEGKATAYVCQNYECQLPTTEIREMLRMLNV

    >gi|21226733|ref|NP_632655.1| hypothetical protein MM_0631 [Methanosarcina mazei Go1]
    MTEHKEVMESIGKKMGFKPNILETLGELDPEFLGKYRRCDGKLLSDGALPAKTKILMALAVVASKQCESCTVAQMKSALN
    HGVTKEEIMETMEVIFITSGAPAVAACREALKLLK

    >gi|21226763|ref|NP_632685.1| arsenite S-adenosylmethyltransferase [Methanosarcina mazei Go1]
    MDANEKKEVIKKRFQEIAMSGGTCCSGGGCCGDSSSSDISRAIGYSEADIEAVPDANMGLGCGNPASIAELKPGDIVLDL
    GSGAGFDCFLAAQKVGNSGKVIGVDMTPEMVEKVQANARKYGYSNVEFRQGDIEALPVEDSSVDVIISNCVINLAPDKEK
    VFREAFRVLKLGGRLYISDLVLLDELPEDLKNDRDLLAG
    CVAGAVLKEEYLKLLKRAGFSVEILAEDPDISKSQYKGLPV
    ESLKLKAWV

    >gi|21226839|ref|NP_632761.1| hypothetical protein MM_0737 [Methanosarcina mazei Go1]
    MKYMKIEILGTGCAKCKKTKELAEKAVKELGVDAEIVKVEDFDKILGYGVMVTPALVIDGDVKVAGKVPSVEDIKKWITK


    >gi|21226845|ref|NP_632767.1| hypothetical protein MM_0743 [Methanosarcina mazei Go1]
    MPFMDEILPETAEAFGKLRSSIFEGGELDRKTKELIAVASSVLMRCQYCVDVHSQRAVANGASKKEVAEAIAVAMFIAGG
    SQLNWANNYGENVYDIIFKEKKPLESGKEKSDEEKGCCCGK

    >gi|21226916|ref|NP_632838.1| peroxiredoxin [Methanosarcina mazei Go1]
    MPLIGDDAPSFTAVTTQGIIKFPDDYKGKWVILFSHPADFTPVCTTEFMTFASMQEEFRSMNTELIGLSIDSVFSHIAWL
    KRIEEKIEYKGMKNLEIKFPVIEDLKMDVAKKYGMVQPKASTTQAVRAVFIIDPEAKIRTILYYPQSTGRNMQEIKRIVV
    ALQKNAAEKVATPANWQPGEDVIIPPPSSMEAVKERMGKEEEGKRCLDWFMCLKKDTQK

    >gi|21226947|ref|NP_632869.1| hypothetical protein MM_0845 [Methanosarcina mazei Go1]
    MTEKIDMDERAKAMAEEIPGVMKALMGLHSEVVKDGALSAKTKELMMVGIAVAIRCEYCLWKHVPEAVKMGATREEILEA
    VSTAIMMSGGPGVAYGSVVVLKILDELNV

    >gi|21226951|ref|NP_632873.1| bacterioferritin comigratory protein [Methanosarcina mazei Go1]
    MPKTSLESGQVSPDFCLPNQEGNQICLENFKGQWAVLFFYPRDNTPGCSLEARSFSDLKKDFEAENAIILGVSRDGKESH
    RKFIEKKELKITLLSDEKAEIHEKYDVMHPKNFRGNEVISTVRTTFLINPEGKIEKVWNNVKAAGHAEKVLSELKTLKGK


    >gi|21226999|ref|NP_632921.1| glutathione reductase [Methanosarcina mazei Go1]
    MEKEYDIIIIGTGTAGRTLAGRAESSGMKFAIIDSREYGGTCPLRGCDPKKVLAGASEATDLNNRLIGKGAGTEEPLKID
    WPSLIRFKRTFTEVYPREAEKMFADMGIDMYHGRARFKNENTVIVGNDELKGKFIFLATGSKPRKLKIPGEEYLTTSEEF
    MELMELPEKIIFAGGGYISFEFTHIARRAGAEVLILHRSERPLGTFDPDLVDMLVRASEESGIKILTNRPVVAVEKAGDG
    FLVRTEYKTETGSEVQVFNADMVVNGAGRVPDIEDLQLENAGVRAEKKGIIVDKHMRTSNPRVYAGGDCTAEGIQLTPVA
    TLQGEVAAANIFDRNGAEADYTGIPSAVFTHPCACFRWNK

    >gi|21227020|ref|NP_632942.1| 4-carboxymuconolactone decarboxylase [Methanosarcina mazei Go1]
    MELEDIVEILKNDPQKVIPKLLDDVREQYGEVPYIMNFMKDLPEIFIPKTLYDNSIMREVKNLDQDTVELISIGVASALR
    CEH
    CLKMHVRIAKRRGISKEKIFSAIMIGASLSNAAVLAESTRALASEFPDENGKNKEEKNEEKEQCDDPDCEVCNIAGA
    HIKQT

    >gi|21227093|ref|NP_633015.1| Thiol-disulfide isomerase/thioredoxin [Methanosarcina mazei Go1]
    MNRLVILLILLAAVLFTAGCTEDGDNSTDAQQIQVSVVENLTALEQINTSVQEGPVLIKFGAEWCGPCQQMKPILSDLAA
    EYTGKATVMSADIDQSRNLSAYFVTSYIPDSFVVVGLEDGEYVYMQDNGNVTKDRFQARVLGVMDKQVYEELLDRAILYH
    ENVNK

    >gi|21227122|ref|NP_633044.1| methylated-DNA--protein-cysteine methyltransferase [Methanosarcina mazei Go1]
    MYYHIIKSPIYPILLAGDEKGLKHLIFLKDERKAKIPNDWVENKDFFREVSNQLEAYFSGKLKTFDVKLAPQGTEFQKSV
    WKALCEIPCGETRTYGEIAKRIQNPKAYRAVGLANNRNPIAIIVP
    CHRVIGANGKLTGYASGLDIKEFLLKLEENNLK

    >gi|21227398|ref|NP_633320.1| NADH oxidase [Methanosarcina mazei Go1]
    MKSMGSNSGAKGTEGGSSRTEGEIQENISENASSNSRTEKEFAKVVIIGGGACGMATATKIRRQSDFDITVLSWDSHTAY
    SH
    CGIPFVLGKEIESLKKLIVKPLAFFRENKINVKLNEKVTSIDLNGQVVITGEGTYPFDRLVIATGSLPFIPRESRANI
    LPYGIFTLRSLADGMLFEKALETARTVCIIGGGTIGIECASALTKRGIRTTLITRGNDLLTRQFDSDMSAIVREHLESLG
    VEVITGESVILPENFWKQKTLILRDRQLPADLVLLATGVKPETWLSRETGITIGKAGGIIVNEMLQVKAGEKFLSHVYAG
    GECAEVIDLITGESRLSQLGTTARSMADVIGNNITGKHSTFGPLADPWVAVAGDLQFGGVGLTSGQAEKQGIKTVTGFSR
    GRTRASYYPGRKDLYIKLLFKNNCLAGAQLAGGEGIKERIDALSLAIRKEATIKDLLNLETCYAPPVSTLVDPLTPAVKA
    AARNMRKIKGKGN

    >gi|21227470|ref|NP_633392.1| glutaredoxin-like protein [Methanosarcina mazei Go1]
    MAKVIVYTTERCPKCNKLKKFLEANAVPFEVADMSTPEALTELRFNGVFTVTAPVLQINNDTFLTHDELFRGDEVDSEKL
    LGIV

    >gi|21227667|ref|NP_633589.1| molybdenum formylmethanofuran dehydrogenase subunit [Methanosarcina mazei Go1]
    MQNEMRLSVFSEKKDRQLVYQPEKCIGCGTCVQACPKGTLSIGAVGAVARGLLDADFLEMAKSEDCLVCGICAKVCPTGA
    LELRQEGKPLTDMSYISRAMRPTSVNESCVHCGLCEDICSQGCIEVTREISTDGKLKVIGKTHIDTECCVHCGWCAAV
    CP
    VNAISVEKPFEGRWSRDENVCQTCHTCIDVCPANAIFNKKAKSGERVEKITHRPDACIYCGACAVACPVDAIDVRKTAIL
    PEMEKKGPLEKKLIEVPAPEDALRTQLETDDDACLGCGNCVIVCPVNAFDNRELAAGYLYDMDEKAILGVKNGKISVVNQ
    ERCGGDGTCALICPVDAIRLVKKEVE

    >gi|21227736|ref|NP_633658.1| methionine sulfoxide reductase B [Methanosarcina mazei Go1]
    MAQNKIEKSEEDWKSVLTPEQYHVLRQKGTERPFSGNLYYNKEKGIYTCAACGQELFSSDTKFESGTGWPSFYDVISSDR
    VRLHEDNSYFMKRIEVVCSRCGSHLGHVFEDGPEPTGQRY
    CINSVSLGFTKEEDTGKEKE

    >gi|21227878|ref|NP_633800.1| Thiol-specific antioxidant protein [Methanosarcina mazei Go1]
    MTDEIRVGETIQDFRLRDQKREEIHLYDLKGKKVLLSFHPLAWTQVCAQQMKSLEENYELFTELNTVPLGISVDPIPSKK
    AWARELGINHIKLLSDFWPHGEVARTCGIFRGKEGVSERANIIIDENRQVIYFKKYLGHELPDIKEIIEVLKNK

    >gi|21228006|ref|NP_633928.1| hypothetical protein MM_1904 [Methanosarcina mazei Go1]
    MNKQNLVYLASFLVILIAILIFAPRGGDRPSGFTNVSVEEAKELLDEEDVFLLDVRTPPEFNSFHIEGATLIPVTNSSGS
    SLSSDKLLEARVDEVPENKKILVY
    CRSGHRSISASKILVNAGYSQVYNMEGGINAWTGAGYPVVSSE

    >gi|21228047|ref|NP_633969.1| hypothetical protein MM_1945 [Methanosarcina mazei Go1]
    MRMLEEFFPEFTEKLDEIDKLYAEKRMIDEKTYQFICFALSIKARSKPCVLKHFKGALEAGATVKELSYIFALVMREAAG
    ADDCWTHDVIGDWKEILKGNISCSCEK

    >gi|21228118|ref|NP_634040.1| HesB protein [Methanosarcina mazei Go1]
    MIEVTEKAAAELKALLEQEGKPDLALRIFVAGVACSGVQYGLALDEEVKEDDVTMESNGIKLVMAKDIERNFSEGSIDYI
    EDENGKGFLIRNPNAGGGCGTCGGCH

    >gi|21228181|ref|NP_634103.1| thioredoxin [Methanosarcina mazei Go1]
    MNGSSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTF
    KFFCHGRPVWEQVGQIYPSILKNAVRDMLQHGEECIRKSTPVGQDITGYV

    >gi|21228315|ref|NP_634237.1| putative glycosyltransferase [Methanosarcina mazei Go1]
    MLEWTGERYLPFIDPGVCGAEIHYEHLHRYAFAAQFVSGKKVLDLASGEGYGSYLLAKEANFVVGVDIDENAVKHASQKY
    QAENLNFVKGSICEIPIKGEKEFDVIISFEAIEHIEEQEAFLSEVKRLLKDDGLFIVSSPNKTLYTDETGQQNPHHVKEL
    YFHEFENLLRKYFSNTIFFGQEV
    CCGSNIWELKQKGISKSLDFVIEKKNTNFDFVDEDSKDPLYYIAVASNCRTEKVEDI
    SSYLVDKSHTLLKQGLTYIRELEEGMHKRENLISGYEGKISDYEEKTSDYEEKISHYKGKISIYEEKVSDYEEKINSLNS
    QISDLNKRSQELEHEIDEMKQSILYKIAMGFQTKFVERALPVNTRRRRTYDTCLLTGRTLINQGPSNLSTSQRKDQKQKK
    DASESSDREKIQDLRPDQTGINIDLYNNMKKSRLHELTAKYVRGKGIQVGPVYHELGITSNIDITYLNHTGQEQISQEQP
    EPEDSVPAKPDKVIDIRSLDKYENEELEFCIVNKVTEKVKDPLEFLNCALRTLKPGGILFLIDSNNADSPETSDEKEEKT
    LSKEYSTEAILKQLNLQEPDLFTVLEDVEYNVEYEKKEAQERVFIAEKGHFEKEITRLLKTSDGIINSKDIELDVIVPVY
    NAYEDTLKCLYSVLKNAGNFRTVLINDKSTDPRIKELFTRLKPFESEKFVLLENPENKGFVKTVNRGMKFSEKDVILLNS
    DTIVTEGWTRKLKRCAYSDEKIGTVTPFTNNGTICSIPNFCENNEIPAGFTIEAFANFIEQISLKKYPEIPTAVGFCMYI
    KREALDKAGYFNEEAFGKGYGEENDFCMRVIRKGYKNVLCDDTFVFHKGEASFSASKAELIKKNLDTLSKMYPDYIPAVS
    KFINSNPLKEIHENIQLRIQAWDIQKKKIMYILHSWGGGTENHVKNLIKKFSKDYKLYVLQVISNKIILTEINNNNVLKY
    IFSMNSQMNRFEFHNEEYEKIISSIIDTFQINLIHVHQLIGHTFDVFNIAKIRNIPIVFSIHDFYSVCPKINLIDYNNKY
    CHGKNNSTDCRICFMDFGITSFSITSWRNNFTDIFEQTTLIIAPSKSTLEILSTYYPNIAGKSIVIEHGHEEELLISRDV
    AKKPRDMRNKPFHIAFIGGLSPGKGRKIFYDLAGSKELRDKTRWSIFGISDIHSDPACYQDLNVTIFGKYRNFLELKKMI
    LENEVDLVIFPAKWAETFSYTLSEAWSIGVPVLVSNLGALKDRVEKNGGGWVVDISETKNVENKILEIISKPEEYIAKTN
    EVQQISLKDLDSMIFEYDTVYKTYLKSITPIYFSQNVFTNNDLLKNIFSENLHTPSETSNIEAEYSANLPRRLVQCYYDN
    GFIYTVNKTKAYVCEAFSRK

    >gi|21228338|ref|NP_634260.1| hypothetical protein MM_2236 [Methanosarcina mazei Go1]
    MISFRRGIDMSFLNEMLPETAEAFGQMRNSIFKDAFLDLKTKELIAVASSVLMRCQFCVDTHSQRAIVAGATKEEIAEAI
    SVAMFVAAGSQIGWTNVYEENVYNRIFEKDKDRKEEDCCCCCED

    >gi|21228342|ref|NP_634264.1| hypothetical protein MM_2240 [Methanosarcina mazei Go1]
    MKRLHKIQDRERISSSFQSFLKKPLPILAIFFVLFSSGCTDINGSESEAETVETAADINNSVSGAGLVEVTDLSQIDEAL
    DKGPVVLKLGSKR
    CIPCQEQEEILTEILPIYQDKASIMLIDVNEYPEFASTFGVRVIPDTCVITVIEDGKYIYMRQDGTE
    SSERANARFLGVVDKATLSETLGKAIEDRNHGE

    >gi|21228345|ref|NP_634267.1| arsenite S-adenosylmethyltransferase [Methanosarcina mazei Go1]
    MDANEKKEVIKKKYQEIAILGGSCCSGGCCGDSNSTDLSRSLGYSESDVQAVPDANMGLGCGNPTAFAELKPGDVVLDLG
    SGGGFDCFLAAQKIGSSGKVIGVDMTLEMVEKAQANARKYGYSNVEFRHGDIESLPVKDSSVDVIISNCVINLAPDKEKV
    FREAFRVLKPEGRMYISDMVLLDELPEELKNDSELLAG
    CIAGAVLKEEYLGLLKKAGFSVEILNEDLDISKRQYRDLPVE
    SLKLKARV

    >gi|21228351|ref|NP_634273.1| hypothetical protein MM_2249 [Methanosarcina mazei Go1]
    MKIEILGTGCPKCKKTKETIEKVLKQTGVEAEVIKVEDIEKIMSYGVMVTPAVVIDGEVKLAGKVPDEKDVRKWMI

    >gi|21228362|ref|NP_634284.1| hypothetical protein MM_2260 [Methanosarcina mazei Go1]
    MRFWLITSKLLIKYILLGGNLKTLTIVLTDGPYISEYAEIASKLAEEALKQYQVNIFLYLDAVHIPKKSQNPSFFNNVGE
    LFTELAEKGAIIRA
    CARCAAARGYLAEEDNTLKGSNCEDYLTGIKISSLYELSEMLKKSDRVISLSR

    >gi|21228428|ref|NP_634350.1| COP associated protein [Methanosarcina mazei Go1]
    MEVETITQETIKVEGMSCGHCVMRVKKAIEDVQGVKKVDVSLENKQAVVEFDEEKTDVEKIKAAVRESGYELA

    >gi|21228430|ref|NP_634352.1| copper-exporting ATPase [Methanosarcina mazei Go1]
    MELAIGVYGMTCGHCQKRVADAIASLDGVESVDVNLEAERAYVNFDPEKLSPEDIMEAVRKAGYSTEREGETEEDKEKVL
    TESSEPAMEEEKAGQVLDSADKGLEYEDKAQGSSQACPLTETCKTAEEKVSRISGQKEGLKEITLGVSGMT
    CSACALNIE
    KVLKKENGVDSATVNLELGRANVSFDPSLISPGQIEEAIESIGYKVEKDRVTLNLQGMS
    CASCAANIERILNKTEGVIST
    SVNFPLEKAVVEFDSSRISVREIIAAVQGIGYGASVQAETVEYEDREQISRDAEILKQRNNLIIALLLGIPVSLGNMSMM
    FPFLSFVPDIFSNHTVLFIMSTLILLFPGRQFFAGTVKGFRHGVTDMNLLIAAGTGSAYLISVAATFLDLGPGYDVLYYD
    TVAFLIIFIVFGRYLETRARGRTSEAIRKLMGLRAKTSRILVDGVEKEVPVEEVVVGDIVIVRPGEKIPVDGIVVEGSSA
    VDESMITGESIPVEKGEGDTVIGATINRMGSFRFRATKVGADTALAQIIRLVEAAQTTKAPIQRIADVFAGNFIVTVHII
    ALLAFFFWFFFGYWFYGVGESEALRGTSPFLFSLLIAITVLVISCPCAVGLATPAAIMVGTGKGAENGILIKGGEALERA
    HKLDTIVFDKTGTLTEGTPKLTDIFAVSGREEKEVLFTAASAEKGSEHPLGEAIVRGAEEQGISLAGAKNFRSIPGKGIE
    AYLEDRRVLLGTRKLMEEYSISFDGLEAEMRRFEENGKTAMLVALGDEAMGLVAVADTLKENSKEAVETLKNMGIEVVMI
    TGDNSITAGAIASEVGISRVLAEVLPEDKANEIKKLQSGGRLVGMVGDGINDAPALIQSDVGIAMGAGTDVAMESAKIVL
    IKNDPIDVVAALRLSRLTIRKIKQNLLWAFGYNTIGIPIAAGILYPFFHRVLITPELAAAFMALSSVSVTTNSLLMKRSR
    IK

    >gi|21228455|ref|NP_634377.1| thioredoxin reductase [Methanosarcina mazei Go1]
    MYDLIIIGGGPAGLTAGIYAVRYGLDTLILERNEISGQISMADIVENYPGFPSISGLELMERFRTHAQEVGVKTTITEVL
    SVRSEGTKKIITTDSGDLEAKAVIIATGANPKHLGVPGEKELISKGVSY
    CAICDGPFFRNKIVAVVGGGNSAVTDALFLS
    KVAQKVYLVHRRDHLKAARVLQDRVDGTPNIELILNSHVLEIVGTREGIKKVEKIILEDVNSRETRELSTNGVFIYVGIH
    PNTEFVDVEKDEGGFIKTDRWMETSEKGIYAAGDCRDTPIWQLVTAVRDGAIAATAAYEYIEKIR

    >gi|21228456|ref|NP_634378.1| thioredoxin [Methanosarcina mazei Go1]
    MFLELQIRSTYLYLEINNRNGNYNLSFWRYLSTVKVTLIHATWCTACPATRRFWNDLKSKYDFEYEEIDVESQEGQALID
    KYGIVGVPTTLIDGEPAFTGLPKKAEAIARIT

    >gi|21228501|ref|NP_634423.1| methionine sulfoxide reductase A [Methanosarcina mazei Go1]
    MIYLKYNCPLTYLILLKLEGGKTVEEKTDAEQRNATSEEDTEIFENPGEGLEKATFAAGCFWGIEEAFRQIKGVVATAVG
    YSGGHFKRPTYEQVCTLDTGHAEAVRVIFDPEIVSYKTLLDVFWKIHDPTTKDRQGPDVGKQYRSVIFYHSDEQKAAALA
    SKEELEKSGAFKNPVVTEIVPVSEFYMAEDYHQQYFEKKGFLQNIFRSFKK

    >gi|21229033|ref|NP_634955.1| hydrolase [Methanosarcina mazei Go1]
    MIFERIKSEGLAHLSYFVGSGNEAIVIDPRRDCQIYFDIARREGMKIKYIFETHRNEDYVIGSLELKELTDAEIYHGKGV
    DFKYGIFVSDGQEFNFGSMKLTALHTPGHTDESMSYALTYPESGKAPLMVFTGDALFVGDVGRTDLYGPEEIPRMAANLY
    ESIFNKILPLGDGVILCPAHGAGSLCGGAISKREYSTLGLERIQNPALQRTDKEEFIKFKLEEKLEFPPYFKKMEQYNLQ
    GPPLLKGLPVPELLFPKEFVKEMEKGAMVVDTRMPHSFGGAHIKGSYGIWLKGLPYYAGWVLPYDKPILLVLEEKDQLET
    AVSYLVRIGYDSIAGFLNGGISSWYMKALPVESLNLISVQSLKDKIEKNEEMVILDVRRDEEWEKGHIEGARHVYVGHLE
    ENLDKVPRNSPIIVY
    CDSSRRSNIAASILKKKGYDMVYNVLGSMTAWKNAGYKVVK

    >gi|21229373|ref|NP_635295.1| glutaredoxin [Methanosarcina mazei Go1]
    MNLFGQKDRGNHVSGVDRGKVIMYGLSTCVWCKKTKKLLTDLGVDFDYVYVDRLEGKEEEEAVEEVRRFNPSVSFPTTII
    NDEKAIVGFKEKEIRESLGF

    >gi|21229381|ref|NP_635303.1| dihydrolipoamide dehydrogenase [Methanosarcina mazei Go1]
    MRGIRMKDYDLIVIGTGSGMNYVNSIIDSNPKMKIAVIDKDEPGGICLTRGCIPSKLLLYPAELVRDLETAPLFGIKLEI
    KDIEFRTIMERMRKRIGEDIEMIRQGLTENDYLDYYPETAEFISPYTLKAGDEILHSEMIFLCTGSKPAVPPVRGLEEAG
    YLTSDTVLGLNE
    CPKSLAILGGSYIGAEYGHFFSAMGAEVTVIGRNQHFLPQEEPEVSELARIKMSEYMRILTNHEAIEV
    RKEKGGQKTVIAKDRDSGEETEVTADEILVATGRAPNNDILHPEKAGIKTDPHGWILVNEYLETSQPNIWAFGDANGKYL
    LKHVGNYESGIVYLNAIMQEKVKVDYHAVPHAVFSYPEIAGVGMSEKEAIEEFGEKRVIIGFKLFEDTAKGSAMETRDYF
    VKVILDGLEDKILGAHIIGPHASVLIHQIIPLMYTASRSAKPMMQMMDIHPALSEVVKRAFYSRLSPEHYHHVMKHLGLE
    DEDSVEG

    >gi|21229394|ref|NP_635316.1| hypothetical protein MM_3292 [Methanosarcina mazei Go1]
    MIIGIIINTSEPETVWNAFRFGTTSLLNDHEVKIFLLGRGVESENIRDEKFNVQEQIKLFMGNSGKIFACGTCLKARQMV
    GSEVCPISTMRDLLHIVEESNRILTFG

    >gi|21229433|ref|NP_635355.1| hypothetical protein MM_3331 [Methanosarcina mazei Go1]
    MKKYDVIVVGAGISGLLAALTLSKHGKKVLVLEKGQHLGGNCNSYIVDGYQVDTGAHAITHLIEGPLPRLMDNYFDFLPV
    FEDYGYYYVRTENALIKVPSNLKDFVTFDVLPRKDRLILSQTLTKALTLSSFGIDLSDQSVYDFLPKNLCKDTYDFVNTI
    SAFLSGKSMKETSAQRILSGSSFVRDSITQEQFDAMIGKFEPKKRQSTESILSSILPYHLHASLQARVDKVAQPFTSLER
    LATNKVNYSQGYPRKGLKALLNAILYSFPDTVEIKSECEVTGILVESEKVYGVEADEIYLADLIIYTGFATDLPELIKDL
    PQAYIEELKGIVHTKSLTIWLGLKEELPEFKYTGSEIWFKDFAYWAMPISNYDPSLAPKDKQLVGFSFVIDSEQTEEHEL
    KKAYDTIFRALPNIEKYIDMQHEQIMIPEKAAVTINGKFSDIRTPVKNLYIAGTDTDRRSMGITRAAYSIIELLKILNED
    GNLH