Methanosarcina barkeri Fusaro uid57715

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|73667705|ref|YP_303720.1| hypothetical protein Mbar_A0155 [Methanosarcina barkeri str. Fusaro]
    MKIEILGTGCSKCNKTKEMVEKAVKEAGVDAEIVKVEDFDIILGYGVMVTPALVIDGDVKVAGKVPSVDDIKKWIKK

    >gi|73667810|ref|YP_303825.1| hypothetical protein Mbar_A0261 [Methanosarcina barkeri str. Fusaro]
    MSKNKSLKISGGILLGTEHKKPNRLINEKSPYLLQHAYNPVKWYPWGEEAFEKARKENKPIFLSIGYSTCHWCHVMAHES
    FEDEEIARLMNRAFVCIKVDREERPDIDNVYMTVCQIILGRGGWPLNIIMTPDMKPFFAGTYIPKNSRFSQTGMLELVPR
    IEEIWNRQHTEVLESADKITSTIQNMISEPAGEGIGESIMEEAYEELLTSFDNEYGGFGRAPKFPTSHKIFFLLRYWRRS
    GNPEALHMVEYTLENMYRGGIHDHLGSGFHRYSTDNVWIVPHFEKMLYDQALIATAYTEIYQVTGKRLYKEAAEGILDYV
    LRDLTSQEGGFYCGEDADVEGEEGKYYLWTLEEVRTVLSPEESELITKVFNLSETGNFEEEIRGRKTGTNIFYMPRSLES
    LAAELNIPADDVDSRVKTAKAKLLLARDKRKRPAKDDKILTDWNGLMIAALAKGFQAFGEEKYLKAAEKAADFILKVLYN
    PDRRLLHRYRDGKTGISGTADDYAFLIHGLLELYEAGFKLDYLKAALCLNREFLEHFWDPIQGGLFFTADDSEALIFRKK
    EFSDAAIPSGNSIEMLNLLRLSRITADSELEDRAQGLERAFSKLIQKIPSGYTQFLSALDFGLGPAYQVVIVGEHESPDT
    GQMLEELWTYFIPNKVLIFRPEGKDPEITKLAKYTEGQVPIDGKATAYVCQNYQCQLPTTEVNEMLRMLNV

    >gi|73667970|ref|YP_303985.1| hypothetical protein Mbar_A0422 [Methanosarcina barkeri str. Fusaro]
    MCSSSTKLQGTKRKKLKETESTIELGERVAKVSMYTISNCPVCRKTKEFFRARGIPFDFIDYDLASESEQNKIAAEMMEG
    TGNIGFPFVRIGEVVVIGFNPERFKQLLKSEEL

    >gi|73668026|ref|YP_304041.1| peroxiredoxin [Methanosarcina barkeri str. Fusaro]
    MEEVENEQIHMPLIGDDAPSFTAVTTQGQINFPDDYKGKWVILFSHPADFTPVCTTEFMTFASMQEEFREMNTELIGLSI
    DSVFSHIAWLKRIEEKIEYKGMKNLEIKFPVIEDLKMDVAKKYGMIQPKTSTTQAVRAVFIIDPEAKIRTILYYPQSTGR
    NMQEIKRVVAALQKNTAEKVATPANWQPGDDVIVPAPSSMEALKERTGKLEENMYCLDWFLCFKKDSKK

    >gi|73668064|ref|YP_304079.1| hypothetical protein Mbar_A0518 [Methanosarcina barkeri str. Fusaro]
    MAGQLPGVMDALSGLHSEVIKDGALSARTKELMMVAIAVSLRCEYCLWKHVPEAVCLGATREEILEAVSTAIVMAGGPAV
    AYGSVVVLTILDELNV

    >gi|73668115|ref|YP_304130.1| glutathione reductase (NADPH) [Methanosarcina barkeri str. Fusaro]
    MENKYDIIIIGTGTAGRTFAGKVAHSGLKIAIVDSREYGGTCPIRGCDPKEVLTNITKVIDSSNRLMGKGVRIDAPLKLD
    WTSLIKFKKTFTEGYSSKTEKHLVGMGIDTYHGRAHFENQNTVVVGMDKLKGEHIFLATGAKPRTLNIPGEEYIITSEKL
    METKKLPEKIIFIGGGYISMEFAHIARRTGAEVTILQRSEKVLRAFDSDMVDLLMKASKAAGIKILTNKPVISVEKDNNG
    LILKVQSQSETEPEIQIFRADMVVQGAGRVADIEDLRLENARIKTEKGAIVVDKHMRTSNSRIYAGGDCALEGMQLTPVA
    ALQGEVAAINVLEGDSAEADYTGIPSAVFTIPVLASVGISVAKDDDKYKVIFQDRSNWYTTRKKGMEFAASKVIIDEAND
    RIMGAHILGPNAEEAINIFASVMRLGLKASDIKKLIFTYPTTCSDIPYML

    >gi|73668143|ref|YP_304158.1| methylated-DNA--protein-cysteine methyltransferase [Methanosarcina barkeri str. Fusaro]
    MYYDIIESPIGPILLAGNEKGLKHLDFLKGKKRIEIPADWIENKKFFREAARQLEAYFSGKLESFDLKLAPEGTDFQKSV
    WKALCEIPYGETRTYKEIAVSIGKPRAYRAVGLANNRNPIAIIIP
    CHRVIGSDGKLTGYASGLDIKEFLLKLEENNLR

    >gi|73668177|ref|YP_304192.1| thiol-disulfide isomerase/thioredoxin [Methanosarcina barkeri str. Fusaro]
    MKKLVILLIMLAAVIFTAGCTDENQENSTDIQAVQESNGIVEANESEQTNLQEIQEENGIVEANESNTTDQETPEESNVL
    EVTSLEQINASLEQGPVLVKIGSKH
    CGPCQAMKPMLEELATEYSGKATIASIDITESPDLEAYFDIGYVPDTSLIVGIKD
    GDYVYIQEDGAVTKDRFKARIQGQMEKEVYENRINLALLQEGKST

    >gi|73668243|ref|YP_304258.1| carboxymuconolactone decarboxylase [Methanosarcina barkeri str. Fusaro]
    MELEDIVEILKKDPEKAVPELLEDVRNQYGEVPYIMNFMKDLPEIFIPKTLYENSIMRGFKNLDPETVELIAIGVASALR
    CEH
    CLKMHIRVAKRKGVSKEKIFYAIMIGASLSNAAVLAESTRALTSEFPDEGNEEEYCCDSNCEICNISKATFK

    >gi|73668286|ref|YP_304301.1| methionine sulfoxide reductase B [Methanosarcina barkeri str. Fusaro]
    MAQKAVEKSEEEWKKVLTPEQYHVLRQKGTERPFSGNLYYNKEKGVYTCAACGQELFSSDTKFESGTGWPSFYDVISSDR
    VRLKEDTSYFMNRIEVVCSRCGSHLGHVFEDGPAPTGKRY
    CINSVSLNFKTEEEGKQGEERM

    >gi|73668497|ref|YP_304512.1| NADH oxidase [Methanosarcina barkeri str. Fusaro]
    MGSDSGTESAVDEIQKAAKSDEKFQEAVSAQNLEKKDPIKVIIIGGGACGMAVATKIRRQSDFEITVISRDSHTAYSHCG
    IPFVLGREIKSFEKLIVKPKDFFKRNRIDVRLNECVSSIDLDLKVVRTGERTYPFDKLVIATGSLPFIPLTGSTNVLPYG
    VFTLRNLDDGVLFEKALKTVERVCIIGAGTIGIECAVALSRRGVKAILINRSKNLLSRQLDPDISEIIREHLESLGIEVI
    SGELAVYPENFWKEKILYVGERQLPADLVLLASGVKPEVSLALEAGIEIGKAGGIIVNEILQVKAGDKAREEFLPYVYAG
    GECVEVTDLITGEAKLSQLGTTARHMADIIGNNITGKSTPLGPLANPWVAVAGDLQFGGVGITSKEAESHGIKINTGFSL
    SRTRASYYPGRKDLYIKLLFKDDILVGAQLAGGEGIKERIDALSLAIRKKTTIRDLLDLETCYTPPVSMLVDPLRLAVKA
    TIRNIKEKKGKQIQEKEMEGKQIQEK

    >gi|73668571|ref|YP_304586.1| glutaredoxin-like protein [Methanosarcina barkeri str. Fusaro]
    MAKIIIYTTESCPKCNKLKNFLEAHSVAFEVEDMSTPEALTELRFNGVFTVTAPVLQINDTFLTHEELFSGGEVNPEKIQ
    EVL

    >gi|73668771|ref|YP_304786.1| 2-cys peroxiredoxin, subunit A [Methanosarcina barkeri str. Fusaro]
    MSGIKIGDKIQDFRLRDHKQKEVHLYDFAGKKVLLSFHPLAWTSVCAEQMKSLEENYEMFTRLNTVAFGISVDPIPSKRA
    WAKELGITHIKLLSDFWPHGEVARSYGIFREKEGVSQRANIIIDEEQKVIFFEEYPMHELPDITKIAKILKQGSKVQL

    >gi|73669158|ref|YP_305173.1| hypothetical protein Mbar_A1649 [Methanosarcina barkeri str. Fusaro]
    MYLLTFKGLIYSAGGTWLNKGNLMYFGSLIFLFLVVFLIFSEQRTEKTSGLEKVSVQEAKEMIEKGDVFVLDVRTPDEFN
    SSHIKGATLIPLSNAFGSNLSSESLLKAHIDEVPKEKILVY
    CRTGRRSDTAGRMLVNAGYTQVYNMVGGIIAWTDAGYPV
    VSSEDTESEGSHN

    >gi|73669207|ref|YP_305222.1| hypothetical protein Mbar_A1700 [Methanosarcina barkeri str. Fusaro]
    MRMLEELFPEFTQKLDEIDQLYAEKRMIDEKTYQFICFALSIKARSKPCVLKHFKGALEAGATVKELSYIFALVMREAAG
    ADDCWTHDVIGDWKEILKGNISCSCAGDEK

    >gi|73669217|ref|YP_305232.1| hypothetical protein Mbar_A1710 [Methanosarcina barkeri str. Fusaro]
    MYLQLEKTKNVQNDKTKHEVKKMKIEILGTGCPKCKKTKEIIEKVLKQTGVEAEVIKVEDVEKILNYGVMVTPAVAIDGE
    VKVAGKVPDEKDIRKWVTQ

    >gi|73669221|ref|YP_305236.1| arsenite S-adenosylmethyltransferase [Methanosarcina barkeri str. Fusaro]
    MDASEKKQVIKEKYGKIAMLGGSCCSSGCCGDSSAIDLSKSIGYSDNDINAVPDANLGLGCGNPTAFAELKPGDVVLDLG
    SGAGFDCFLAAQKVGKSGKVIGVDMTQAMVEKAQANSQKYGYTNVEFRLGDIEALPVENGSVDVIISNCVINLAPDKENV
    FKEAFRVLKPEGAMYISDMVLLAEIPENLKNDKDLLTS
    CLAGALLKGEYLGLLKRAGFLVEVLNEDLDISKRQYNELPAE
    SLKLKAWK

    >gi|73669223|ref|YP_305238.1| hypothetical protein Mbar_A1716 [Methanosarcina barkeri str. Fusaro]
    MKRLHRIPSKERTSFLSFPLIKSLSILAIFCLFLFSSGCTDLDDSGNEAEPAEVTKNISDSGSGMELIEVTNLSQIDKAL
    KKGPVALKLGSKG
    CIPCGEQEEIFSELLPMYQDSASFMLIDIKQYPEFATEFGVRVIPDTCIITDIENGKYVYMRQDGSK
    SQERESARFLGVTDKETLSETLDKAIESKKTEG

    >gi|73669227|ref|YP_305242.1| 4-carboxymuconolactone decarboxylase [Methanosarcina barkeri str. Fusaro]
    MSFLDEMLPETAEAFGQMRNSIFKDGYLDLKTKELIAIASSVLMRCQFCVDTHSQRAIAAGATKEEIAETISVAMFVAAG
    TQIGWTNIYRENIYDKIFEKDKREEDCCCCCKD

    >gi|73669232|ref|YP_305247.1| hypothetical protein Mbar_A1725 [Methanosarcina barkeri str. Fusaro]
    MKTLTIVLTDGPYISEYAEIAYKLARAALKQYKVNIFLYLDAVHIPKKSQDPSFFTSAGQLFSGLTEKGVVIRACARCAS
    ARGYIPEEEIIQGSNCRDYLPGIRITSLYELSEMLNKSDRVISLSR

    >gi|73669364|ref|YP_305379.1| thioredoxin [Methanosarcina barkeri str. Fusaro]
    MNGSNVIEIQDTTWGEVVESSKKPVIVMFYSPTCPYCKAMEPYFMNYAREYKNSAIFARVNIETSPWTTERYGVQGTPTF
    KFFCHGRPVWEQVGQIYPSILKTAVEDMIHYGEECIRKSTPVGQDITGYT

    >gi|73669387|ref|YP_305402.1| mercury ion binding protein [Methanosarcina barkeri str. Fusaro]
    MTQEIIKVEGMSCMHCQLRVKKAVEAVEGVQRADVNLQTKQVTIDFEEGKENLKKVKAAIRETGYEPI

    >gi|73669393|ref|YP_305408.1| mercury ion binding protein [Methanosarcina barkeri str. Fusaro]
    MTQETIKVEGMSCMHCQMRVKKAVEAVEGVQKADVNLQTKQVTVDYEEGKVNLEKVKDAVREAGYEPA

    >gi|73669394|ref|YP_305409.1| P-type copper-transporting ATPase [Methanosarcina barkeri str. Fusaro]
    MEVTIKVYDMTCGHCQKRVADAISSLEGVESVDVNLESESATVSFDSEKVSLDDIKAAIQKAGYPTESENEVQEEAGAEV
    PEITEAEGETSKTAEPTLKEPKEPEEAPKTCPLTETCALPEEEPQTLGLKTGRKEITLGVSGMT
    CSACASNIERVLKKKA
    GVDSAVVNLELGRANVSFDPSLISPKEIGETIESIGYKVEKDSVTLSLEGMS
    CASCAANIEKVLNRTEGVISASVNFPLE
    KAVVEFDSSRVSVREIIAAVQGIGYGAFVKTEAVEYEDREQMSRDAEIRRQRNNLIIALVLGIPIGLGNMSMMFPFLSFV
    PDFLSNHIVLFILSTLVLLFPGRQFFVGTIRGFKYGVTDMNLLIAAGTGSAYLISVAATFLDLGPGYNSLYYDTVAFLII
    FIVLGRYLEARARGQTSEAIRKLMGLRAKTSRILVNGIEKEIPVEEVAVGDIVVVRPGEKIPVDGIIVEGGSAVDESMLT
    GESIPVEKFPGDTVIGATLNKTGSFNFRATKVGADTALAQIIRLVETAQTTKAPIQRVADVVAGNFIVTVHIIALLAFFF
    WFFIGYWRYGVGESVTLGGISPFLFSLLIAITVLVISCPCAVGLATPAAIMVGTGRGAENGVLIKGGEALERAHKLDTIV
    FDKTGTLTAGTPKLTDLVAVSGHEEKDVLFIAATAERGSEHPLGEAIVNGAEEQGIRPGKAENFHSIPGKGVEAYFEEKR
    ILLGTRKLMEEEGFSFKELEAEMRAFEESGKTAMLVAFGEEIIGLVAVADILKENSIEAIETLNKMDLEVVMITGDNAVT
    ANAIAKEVGIPRVLAEVLPEDKASEIKKLQEEGKLVGMVGDGINDAPALIQSDVGIAMGAGTDVAMESAKIVLIKNDPRD
    VVSAIKLSRLTINKIKQNLLWAFGYNTIGIPIAAGILYPFIHRVLITPEFAAAFMALSSVSVTTNSLLMKRSKL

    >gi|73669455|ref|YP_305470.1| CoB--CoM heterodisulfide reductase subunit A [Methanosarcina barkeri str. Fusaro]
    MNAALDKTAVFICHCSGNISERVDINTLKKTLKAEGIPVFDYEYLCSREGQTLIKNKISEGNLDRIVIGSCTPSKHGTLF
    KKCIQEAGLNRAMLEIANLREHCAWVHPDKAGATEKALSLLRGKLNRLENQEPLEEIKVNIVPQALVIGGGIAGITAAVN
    LADNGISTYLVEKESSIGGNMAKIGKVFSPDKLAEECAM
    CSLSPLMNEVVANPKITLLTWTEVERLSGSAGNFTVRLKKK
    PRYVHDNCTGCGRCSRVCPVLVENEFNCGYMDKKAISLRFSQSVPKIYCIDPDQCLQFKGETCGKCAEVCKSGAIDFSQK
    EEIIELNVGAVIVATGFEEYDASQKPQYGYGIFKNVMTQMELARMLGINGPTKGTLIRPSDFSLNPDAVSSTGTCGSKSS
    LENSSENSSENSPGIPKRIVMIQCVGSRDEKESGNRYCSRYCCMAALKHSNLIMKKYPGTEVTICYVDLRALGFYENYYR
    AVQDMGVRFVRGRPAEIVEKPDKSLLVRLEDTLNQKITELPADLVVLSAAMVPSKGTRKIASILNISQDESGFIKERHSK
    LRPVDSSLDGIFVCGTAQSPKDVTDTISQAGLAAVRARAFIADSPKALVNEIPTINQLLCDQCKECLKCPFEAFSLNENG
    KVIVDPLVCTGCGYCTELCQNGAIQIEGFTKNQLKAEVEGVVEEGDLIGFVNSGIASLTCDNIGNSALTYPSNVKLIKVP
    TNLVVDKDLLLHAFKRGASAVLFVEDPPDSPKAEIIYPLTVSHFEKLKKELGDSGSRLYFKKAYVPNTRGLAGTFTSLAQ
    EGEMIK

    >gi|73669474|ref|YP_305489.1| hypothetical protein Mbar_A1975 [Methanosarcina barkeri str. Fusaro]
    MTKVEKALLLLKNMVYESTSPKETLKFAKYYRNKGLDVLVILWGPMGVLLAKKDKTRGSPKYDDTVQECIDMGVEFRCCQ
    LASDMIGLKKEELIPGIEFICSKEVAELFLKYTEENQLIITF

    >gi|73669645|ref|YP_305660.1| hypothetical protein Mbar_A2151 [Methanosarcina barkeri str. Fusaro]
    MFLFGLIIWYQFRPGVLMAKVEKVLLLLKNMVYESTSPQETLKFAKYYRNKGFKVLVILWGPMGVLLAKKDKNRGSPKYD
    STIQECIDMGVEFKC
    CQLASDMIGLKKEELIPGIEFICSKEVVELFLRYTEENQLIITF

    >gi|73669647|ref|YP_305662.1| hypothetical protein Mbar_A2153 [Methanosarcina barkeri str. Fusaro]
    MAKIEKVLLLLKNMVYESNSPQETLKFAKFYRSKGLKVLVILWGPMGVLLAKKDKTRGSPKYDSTIRECIDMGVEFRCCQ
    LASDMIGFKKEELIPGIEFICSKNIAELFLTYTEENQLIINF

    >gi|73669773|ref|YP_305788.1| thioredoxin [Methanosarcina barkeri str. Fusaro]
    MTNMNKLVVLLILIAAVILTAGCINSKANVTNPQEAQENSMNNSQNSTVVEVTQLDQINTSLENGPVLLKLGAEWCEECQ
    ELNPVLAQVATDYAGRATVMTIDIDKSKELADYFGIYVIPDSSVIVGIESGKYVYMQEDGNATTERSTARILKIEGKEVY
    ENVLDLALQKEKN

    >gi|73669799|ref|YP_305814.1| thioredoxin [Methanosarcina barkeri str. Fusaro]
    MKPMLLDFSATWCGPCRMQKPILEELEKKYGDKVEFKVVDVDENQEMASKYGIHAVPTLIIQKDGTEVKRFMGVTQGSVL
    ASELDKIL

    >gi|73669914|ref|YP_305929.1| glutaredoxin [Methanosarcina barkeri str. Fusaro]
    MDVSTLNKEKGDHISGIDRGKVVMYGLSTCVWCKRTKKLLTDLGVDFDFIYVDRLEGKEENQAVEEVRHFNPSTSFPTTV
    INGEKAIVGFKEKEIREALGFQG

    >gi|73669935|ref|YP_305950.1| hypothetical protein Mbar_A2454 [Methanosarcina barkeri str. Fusaro]
    MADHKTVTESIEKKMGFKPQILETLEELDPEFLSKYRRCDGKLLADGALPAKTKILMALAVVASKQCEACTVAQMKSALN
    HGVTKEEIMEAMEVIFITSGAPAVAACREALKLLK

    >gi|73670053|ref|YP_306068.1| thioredoxin [Methanosarcina barkeri str. Fusaro]
    MKQLVIFSILIIAVLFTAGCAEPNPTQESHDNGYVVNTTELGQINTSLEEGPVFLKIGAEWCGPCQKMEPILQELANKYE
    GKATIMSVDIDQSPEFIEYFGVNPIPDSCVIIGIENGEYVYIQEDGNASKDRFTARILGLRDKQEFEKVLDLALQKENIK
    SK

    >gi|73670065|ref|YP_306080.1| CoB--CoM heterodisulfide reductase subunit A [Methanosarcina barkeri str. Fusaro]
    MRIGVYICHCGLNIAGVIDVLALQEMAAKLEDVVLAREVQFLCSDSGQEGIIKDIKENKIDRVVIAACSPRLHEKTFRHV
    MEKAGLNPYLMEMVNIREQCSWVHADDPQMATQKAFDLIRMGVAKAKFLKELSATSSKASRNVLIIGGGVAGIEAALNLA
    EAGFPVTMVEKESTIGGKMALMNEVFPTNDCSI
    CVLAPKMTEVQNHPNITLYTYSEVTDISGSVGKFHVKVTRKPRFILE
    DKCKGCVDLCSAVCPVEIENPMNYGVGKTRAIYMPIPQSVPQVVLIDPDHCVGCGLCLQACPADAVDYEQKPEEIEFEAG
    AVIVSTGYQLFDASRKKEYGFGKYPDVITNMQLERMLNSAGPTGGRVIVPSTGKPPKSVAFIQCVGSRDKTVGNEYCSRV
    CCMAALKNSQMVKERYPDTEITIHYIDIRAAGEMYEEYYTRTQSMGVDFIRGKVAEIYAGEDGRPVLRYEDTLESRIEEE
    ACDLVVLSTGYEPSKSAEGIGRMLNLARRPDRFFASAHPKMRPVDAPVSGVFLAGCASGPKEIQVSIAQGSACASKVMQL
    LGTGELEADPMGAHVDPEKCIGCRTCLEVCKFGKIKIENKKAVVDEVSCYGCGDCSAACPAGAIQMRNFENEQILAQVRE
    ATAHKSQSPFIVAFLCNW
    CSYACADLTGMSRLHYPTNIRVIRTMCSARVNPEFVLEALKGGADGVLVAGCRMDECHYIHG
    NFDAKQRMDVLQEVLKEIGLDPRRLRTLWISAAEGERFSNTITEFVKELEGIGPIGTEFKLEETGTELEEVA

    >gi|73670115|ref|YP_306130.1| hypothetical protein Mbar_A2644 [Methanosarcina barkeri str. Fusaro]
    MDKFIKDKINQSINDRVQHHSRFLENCNTYNSFLKLEKKAFEAGCLSRKHKELMALSISIVTKCEPCIEWHVQQACLAGA
    SDKEIYETIDVAIEMGGGPAAAYSRFALNALDFHKEESSENKKSGKQA

    >gi|73670165|ref|YP_306180.1| dihydrolipoamide dehydrogenase [Methanosarcina barkeri str. Fusaro]
    MENYDLIIIGTGSAMNYINPILDSNLKMRVAVIDKDEPGGICLTRGCIPSKILLYPAELIREIETASIFGIKLEIKDIDF
    LAIMERMRRKSGEDIEAIRKSLTDDPYLDYYHESAEFISPYTLKVGEKTLHSKMIFLCTGSKPAIPTIKGLEEAGYLTSD
    TVLKLTE
    CPKKLAILGGSYIAAEYGNFFSAIGSRVTVIGRNSQFLPQEEPEISRLASMKMSEYMQIITNHEAIEVRKEDN
    GQKTVVARNKNSGKEVKVTVDEVLVATGRAPNTDILHPDRAGIKTDTHGWILVNEFLETSQPNIWAFGDANGKYLLKHVA
    NYESGIVYLNAILKEKAKADYHAVPHAVFSYPEIAGVGMREQEAVEKYGEERILIGLKFFEDTAKGSAMEIRDYFVKVIL
    DSEEEKILGAHIIGPHASVLIHQIIPLMYTESRSPEPIMRGMDIHPSLSEVVTRAFYSRLPPEHYHHFLKHIGLED

    >gi|73670197|ref|YP_306212.1| hydrolase [Methanosarcina barkeri str. Fusaro]
    MKFERIKSEGLAHLSYFIGSENEAIVIDPRRDCQVYVELARREGMNIKYIFETHRNEDYVIGSLELKKLTDAEIYHGHGV
    GFKYGNYLNEGQEFDFGSMKLTALHTPGHTDESMSYFLADLDTGKEPVMVFTGDALFVGDTGRIDLYGPEEAPRLAANLY
    DSIFNKILPLGDGVILCPAHGSGSVCGGAIAKRDYSTLGLERVQNPALQKTNREEFIKFKLEEQLDFPPYFKKMEQYNLQ
    GAPLLQGLPTPKPLSPAEFRTEIEKGAVIVDTRMPHSFGGTHIRNSYSIWLGGVPSFAGWVLPYNKPILLVLEEKEQLEA
    AIRYLVRLGYDNIKGFLSGGISAWYMKALTVDEVSLISVHDLKNKLEKHEEMTLLDVRKEKEWDEGHIQGAKNIYVGELE
    ENLDKVPKDSRVIVY
    CDSSRRSSIAASILKKHGYNNVSNVLGSMTAWKNAGYNTVK

    >gi|73670280|ref|YP_306295.1| methionine sulfoxide reductase A [Methanosarcina barkeri str. Fusaro]
    MEENQNAELNPDYFENPGSDLKKATFAAGCFWGIEEAFRQVKGVVATAVGFSGGHFERPTYEQVCTLDTGHAEAVRVIFD
    PKVVSYETLLDVFWKIHDPTTKDRQGPDVGKQYRSVIFYHDEKQKASALASKEKLEKSGVFKNPIVTEVVPVSEFYMAEE
    YHQQYFEKKGFLQNILRGLKK

    >gi|73670361|ref|YP_306376.1| thioredoxin reductase (NADPH) [Methanosarcina barkeri str. Fusaro]
    MYDLIIIGGGPAGLAAGIYAVRSGLNTLILERSEISGQIALSDIVENYPGFPAISGLELMEKYKAHAQAVGVETKITEVL
    SVRAEGEKKIISTDSGDLESIAVIVATGANPKHLNVPGEKEFISKGVSY
    CAICDGPFFKNKTVVVVGGGNSAVTDALLLS
    KIARKVYLIHRREQLRAVKVLQDRVFATPNIEFIFNAQILEIMGSSGGVRRVEKIRFKDLKSEEQRELATDGVFIYVGIH
    PNTEIIDVDKDDEGFITTDRFLETSKKGIYAVGDCRDTPIWQLVAAVRDGALAATAANVYIESIKKETT

    >gi|73670476|ref|YP_306491.1| hypothetical protein Mbar_A3017 [Methanosarcina barkeri str. Fusaro]
    MKRYDVIVVGAGISGLLAALTLSKHGKKVLVLEKRRNLGGNCNSYMVDGYQVDTGAHAITHLIEGPLKRLMDNYFDFLPM
    FEDYGHYYIRTENTFVKIPSNLKDFVTFDVLPRKDRVLLSQTLTKAFTLSSFGIDLSSQSVYDFLPKSLSKETYDFVDTI
    SAFLSGRSMKETSAQRVLSGSSFVRDSITQEQFDAMIGRLEPKKSQSTESILASILPYHLHASLQARMTKVTQPFTSLER
    LATNNVNYSQGYPRKGLKALLNAILYSLPETVEIKNECEVKSILVQDGKVSGVEADEIYISDLVIYTGFATELPRLIKDL
    PKEYKTNLESIVHSKSLTIWLGLEKEFPNFNYTGSEIWFKDFAYWATPISNYDPSLAPKDKQLIGFSFVIDENKSEKQET
    KKAYDTIFRAHPNIENYIDMQHEQIMVPEKAAVTINGQFADIRTPVRNLYVAGTDTDKRSMGITRAAYSIIELLKILNED
    GNLH

    >gi|73670634|ref|YP_306649.1| hypothetical protein Mbar_A3185 [Methanosarcina barkeri str. Fusaro]
    MKKYDVVVVGAGISGLLAALTLSKHGKKVLVLEKNQHIGGNCNSYMVDGYQVDTGVHAITHLIEGPLKRLMDNYFDFLPV
    FEDYGHYYIRTENAFVKVPSTLKDFVTFEVLPRKDRLILSQTLTKAFTLSSFGIDLSDRAVYEFLPKSLSKDTYDFVDTI
    SISLSGKPMKETSAQRILYGSNFVRDSITQEQFDAMIGKLEPKKPQSTESILASILPYHLHASLQARMTRLLSRLHLWKD
    LQQMI

    >gi|73670865|ref|YP_306880.1| ArsR family transcriptional regulator [Methanosarcina barkeri str. Fusaro]
    MEKETRVFKDSVYAQLARIGKAISSPRRLEILDILMQGSKTVETIARETDMSVANTSQHLQTLLESRLVEYEKRGVYSYY
    KLADRKVANFILSLQLLAEKRITELQKLREEIYTNRDNIEQIKMSELIVRMKEGNVTLIDVRPKEEYEMMHIPGANSIPL
    EDLEKHLATLPINQEIVAY
    CRGRCCLLSVEAVEILRAHGFKAVRLEASVQEWLSQNDDEYNNAHNCCNKKNSII

    >gi|73670887|ref|YP_306902.1| hypothetical protein Mbar_A3449 [Methanosarcina barkeri str. Fusaro]
    MNKQYLSGFAAILIALLIIVPGIAGAVPKIGCTVTAGYENVTACQAKSILEDKGVFLLDVRTPAEYSYSHIEGATLIPLK
    NVPSHDPVNLSDDQLLPNRMNELPKNKNTKIVVY
    CYTGKRGSAASQMIADAGYKRVYNIQGGLTAWVNAGCPVVVVTDSA
    TWSANYPHYV

    >gi|73671047|ref|YP_307062.1| thioredoxin [Methanosarcina barkeri str. Fusaro]
    MKKSVILLILLVLVLFTAGCDEKTPENSTSSEANMEKSVVAITQLEQVNTSLQKNPVFVKVGSRWCPECRSLKPVLDKLA
    VEYQGKATIASIDADKNLELAEYFEVEFIPDSFVIVGIENGTYVYMQENGNVSTDRSKARFVGRNDTDEEMFKNVLNLAL
    IQKEKADANETKR

    >gi|73671060|ref|YP_307075.1| cell surface glycoprotein (S-layer protein) [Methanosarcina barkeri str. Fusaro]
    MKRKRIQVILIIFLFMLWTAITQTEAAVVTVNNSGDGNYSSIQEAINNSHDGDTVLVSPGVYRENIIVNRELTILSHPML
    SGSQTNRTYIIGTVSDNAVFSISSDNVTLNGFHIAGDPFGKDMSQEVGLYLEGVRNCSLNNNTLILTDQGIVLKSSQDNH
    LDGNLVSLGNEGIVLDNSEENVLSNNWVVRNNQGISLNNSFNNNLVNNTAGSNGVGILLQMSQGNKLAYNLILKNEYGVL
    GQVAGSNILTNNNLYFNDIGVDLRGSSNNSFYENEFVNFLNAADEGNNIWNSSSTGNFWNDHTGADADGNGIIDNQYAIN
    QITGAIDYMPLINRISSGSGSEALGANGYILLVLFEKKYPENSTGNREKGAVIETTELGQINKFLEEGPVFLKLGAEW
    CG
    A
    CQSMKPILDELVSKYGDRATIMSININKNPQLATYFDVGYIPDSSMIVGIENGTYVYMQLDGNITTDRVRARIVGLEDK
    EVYEKVLENALTYEEKSKSK

    >gi|73671080|ref|YP_307095.1| HesB protein [Methanosarcina barkeri str. Fusaro]
    MIEVTDRAAAELKTLIEQEEKPELALRIFVAGVACSGIQYGLAFDDETKEDDVTMESNGIKLVMAKDIERSFSEGSIDFV
    EDENGKGFLIRNPNAGGGCGTCGGCH

    >gi|73671099|ref|YP_307114.1| carboxymuconolactone decarboxylase [Methanosarcina barkeri str. Fusaro]
    MGEHGEGSHERHHEEHGEFEHEELLKSMSEKLGFTPHILEILGELDSESLKKYSRCDKKLLSDGALPAKVKILIALAVVA
    SKQCER
    CTVVQMQSALKNGATKEEIMEVMDVIFITSGAPAVAACRDALKLLK

    >gi|73667776|ref|YP_303791.1| putative oxidoreductase [Methanosarcina barkeri str. Fusaro]
    MQELNGEKTVKAKKERTPMPEQPAEERRKNFNEVALGYTKEDALAEASRCLSCKEPKCVEGCPVNVDIPGFIKLVCEEDF
    AGAIEKIKGTNALPAICGRVCPQETQCEALCVLGKKGQPVAIGRLERF
    CADYERQQGVKVPEVPEPTGKKVAVVGSGPAG
    LTAAADLAKLGHKVTVFESLHKAGGVLSYGIPEFRLPKEIVRQEVEYIEKLGVEFKPNYIIGRIKTLDELCDEFDAVFMG
    TGAGLPNFMGIPGENFNGVYSANEFLTRVNLMKAYDPEYDTRVRLGRHVVVVGGGNVAMDSARSALRLGAEEVSIVYRRG
    EEEMPARREEIEHAKEEGITFRLLTNPVRILGDDKFNVTAVECIKMKLGEPDKSGRRSPVPVEGSEFTIPAEVVVIAIGT
    SPNPMIFKGSEGLDQNKKGTVVADEETGATSKCGVFAGGDVVTGAATVISAMGAGKKAAKAIDEYLKEQ