Methanosarcina acetivorans C2A uid57879

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|20089340|ref|NP_615415.1| methionine sulfoxide reductase B [Methanosarcina acetivorans C2A]
    MHKGGLQLAQNKIEKSEEEWKKILTPEQYHVLRQKGTEKPFSGNLYYNKEKGVYTCAACGQELFSSDTKFESGTGWPSFY
    DAISSDKVRLKEDNSYFMHRIEVVCSRCGSHLGHVFEDGPVPTGKRY
    CINSVSLGFEKEEEAEREEK

    >gi|20089505|ref|NP_615580.1| 2-cys peroxiredoxin, subunit A [Methanosarcina acetivorans C2A]
    MTNEIKIGETIQDFRLRDQKRDEVHLYDFKGKKVLLSFHPLAWTKVCAEQMKSLEENHELFTELNTVAFGISVDSTPSKK
    AWAKELGIMHIRLLSDFWPHGEVARTHGIFKEKEGVSERANIIIDEDQKVIFFKKYPGHELPDIKEIIEVLKK

    >gi|20089549|ref|NP_615624.1| electron transport complex RsxE subunit [Methanosarcina acetivorans C2A]
    MYPHRRADMNPISEFIRGITKDNPTFGLVLGLCPTLAVTTSVENGIGMAMGTLFVLVGSNMMVSAIRKGIPGTVRLPVEI
    IVIATFVTIVDMVMEAFTPDLYTSLGVFIPLIVVN
    CIVIGRAEAYALKNGVFYSIIDALGEGTGFLLVLILIGGIRELLG
    TGIIDPFGMTLINLSGVINPAMFMTMSPGAFLTIAVLMTIVNYRRQQKAAKGG

    >gi|20089550|ref|NP_615625.1| Na+-transporting NADH:ubiquinone oxidoreductase, subunit 5 [Methanosarcina acetivorans C2A]
    MVKMAESLFTIFLEGVFIKNFLLIQFLGLCSFVGVTKDLKSASGMSGAVVFVMAMAATVSFALYNFILVPLKLEFLRTIA
    FIVVIAALVQLVEFIVRKHVPALYRSLGIYLPLITTN
    CAVLGAVLLNVMNDYDLAQSVVFGVAAGLGYTVAMLMMAAIRE
    RSDLVEVPKSVGRGVTYAFFIATIMSMSFVNFFGVIPLE

    >gi|20089631|ref|NP_615706.1| hypothetical protein MA0746 [Methanosarcina acetivorans C2A]
    MNKQDLTYIAIFLVFLITVLLFALRPEDSPSVPESPAGFETVSVEEARGMIEKDEVFILDVRTPAEFNSSHIEGATLIPV
    TNSGGSNLSPDQLLEARINEVPRDKKILVY
    CRTGHRSITASKILVTAGYSDVYNMEGGITAWIGAGYPVVS

    >gi|20089680|ref|NP_615755.1| hypothetical protein MA0796 [Methanosarcina acetivorans C2A]
    MRMLEEFFPEFTQKLDEIDQLYAEKRMIDEKTYQFICFALSIKARSKPCVLKHFKGALEAGATVKELSYIFALVMREAAG
    ADDCWTHDVIGDWKEILKGNIFCSCEK

    >gi|20089782|ref|NP_615857.1| HesB family protein [Methanosarcina acetivorans C2A]
    MIEVTEKAAAELKTLLEQEGKSDLALRIFVAGVACSGVQYGLALDDEVSEDDVTMESNGIKLVMAKDIERSFTDGSIDYI
    EDENGKGFLIRNPNAGGCGTCGGCH

    >gi|20089843|ref|NP_615918.1| thioredoxin [Methanosarcina acetivorans C2A]
    MDENYVFEIEDATWGQQVEDSEKPVIVMFYSPTCPYCKAMEPYFAEYAKEYRASAIFARINIIVNPWTAERYGVQGTPTF
    KFFCHGKPVWEQVGQIYPSILGNAIRDMIQYGEECIRKTTPVGQDITGYV

    >gi|20090187|ref|NP_616262.1| mercury ion binding protein [Methanosarcina acetivorans C2A]
    MGSITGKGVFSLVQETIKIEGMECDHCVMRVGRAIASVEGVVEVDVSLEKKEAVVDFEDNRTDSGKIRDAIREAGYEPL

    >gi|20090198|ref|NP_616273.1| mercury ion binding protein [Methanosarcina acetivorans C2A]
    MTQETIKVEGMSCGHCVMRVKKAIEGVQGVQKVDVSLENKQAVVEFDEGKTDVEKIKAAIKESGYEPV

    >gi|20090203|ref|NP_616278.1| P-type copper-transporting ATPase [Methanosarcina acetivorans C2A]
    MEVTIGVYGMTCGHCQKRVADAISSLEGVESVDVNLEAESATVIFDPGKVSPDDIKGTVLKAGYSTEPEVETEEETRIET
    PEPARGEAPAGPVLESSEGALEGSETGVGEGEDERTEKGAEEEVEGAPQTCPLTEACPLVPLAEEAEKEESYLAGQNKGL
    KEITLGVSGMT
    CSACALNIEKVLKKKEGVASVAVNLELGRAKVSFEPSLISPQEIGEAIESIGYKVEKDKVTLNLQGMSC
    ASCAANIEKILNKTDGVISVSVNFPLEKAFVEFDSSRISVREIISAVKGIGYGASVQAETVEYEDREQVSREAEIRRQKN
    NLIIALLLGIPISLGNMSMMLPFLSFVPPIFSNPMVLFVLSTLVLLFPGRQFFVGTFKGFKHGVTDMNLLIAAGTGSAYL
    ISVASTFLDLGPGYNSLYYDTVAFLIIFIVFGRYLEARARGRTSEAIRKLMGLRAKTSRILVDGEEKEVPVEEVVVGDIV
    VVRPGEKIPVDGVIVEGSSAIDESMITGESIPVEKGTGDTVIGATLNKTGSFRFRATKVGADTALAQIIRLVEAAQTNKA
    PIQRIADVFAGNFIVAVHIIALLAFFFWFFIGYWRYGVGESAELGGISPFLFSLLIAITVLVISCPCAVGLATPAAIMVG
    TGKGAENGILIKGGEALERAHKLNTIVFDKTGTLTEGTPKLTDVFAVPGREENEVLFIAATAEKGSEHPLGEAIVKGAED
    RKISLAEAKKFRSIPGKGIEAYIEDQKILLGTRKLMEESSIPFEGLETEMRTFEEHGKTAMLVASGDEAIGLVAVADTLK
    ENSKDAVETLNKMGIEVVMITGDNAITAGAIAAEVGIPRVLAEVLPEDKANEIKKLQMEGKLVGMVGDGINDAPALIQSD
    VGIAMGAGTDVAMESAKIVLIKNDPKDVVAALKLSRLTINKIKQNLTWAFGYNTIGIPIAAGILYPIFYQILITPALAAA
    FMALSSVSVTTNSLLMKRSRIK

    >gi|20090229|ref|NP_616304.1| thioredoxin reductase (NADPH) [Methanosarcina acetivorans C2A]
    MNSFLFSGGNMYDLIIIGGGPAGLAAGIYAVRFGLDTLVLEKSEISGQISMSDIVENYPGFPSISGLELMEKYRTHAQEV
    GVKTKITEVLSVRTEGAKKIVSTDSGDLEAKTLIIATGANPKHLGVPGEKEFISKGVSY
    CAICDGPFFKNKTVVVVGGGN
    SAVTDALLLSKVAQNVYLIHRRDRLKAAKVLQDRALATPNIEFILNTLVQEIAGSREGVKKVEKVILQDLNSKESRELST
    NGVFIYVGIQPNTEFVNVEKNNEGFIITNRWMETSEKGIYAAGDCRDTPIWQLVAAVRDGAIAATAANEYIESLK

    >gi|20090230|ref|NP_616305.1| hypothetical protein MA4683 [Methanosarcina acetivorans C2A]
    MAKVTLIHATWCTACPATRRFWKDLKTEYDFEYEEIDVENPEGQALIEKHGIVGVPTTLIDGEPAFTGLPKKADAIARIT
    RR

    >gi|20090291|ref|NP_616366.1| methionine sulfoxide reductase A [Methanosarcina acetivorans C2A]
    MEGNEKAEQKNATSEESTDIFENPGEGLEKATFAAGCFWGIEEAFRQVKGVVATAVGYSGGHFEKPTYEQVCTLDTGHAE
    AVRVIFDPKVVSYKNLLDVFWKIHDPTTKNRQGPDVGKQYRSVIFYHNEEQKAAALASKEELEKAGVFKNPIVTEIVPVS
    EFYMAEDYHQQYFEKKGFLQNILRSFKK

    >gi|20090505|ref|NP_616580.1| dihydrolipoamide dehydrogenase [Methanosarcina acetivorans C2A]
    MKNYDLIVIGTGSGMNYVNSIIDSKPEMKIAVIDKDEPGGICLTRGCIPSKLLLYPAELVREIWTAPLFGIRLEIKDIDF
    RMIMERMRRRIGKDIDTIRDGLNEDTYLDYYHEAAEFISPYTLRVGEETLHSEMIFLCTGSKPSIPPVKGLEETGYLTSD
    TVLELEERPKSLAILGGSYIGAEYGHFFSAMGAEVTVIGRNSHFLPQEEPEISELARIKMSEYMKIITNHEAIEVRKESN
    GQKTVVAKDRKSGEEIKITADEILVATGRTPNTDILHPEKAGIKIDSQGWIMVDKYLETSQPNIWAFGDANGKYLLKHVG
    NYESGIVYLNAIMKEKVRADYHAVPHAVFSYPEIAGVGMSEKEALEEYGENRVVIGFKLFEDTAKGSAMEARGYFVKVIL
    DSLEETILGAHIIGPHASILIHQIIPLMYAPSRSAKPIIRSMDIHPSLSEVVTRAFYSRFSPEQYHHIMKHLGLED

    >gi|20090511|ref|NP_616586.1| glutaredoxin [Methanosarcina acetivorans C2A]
    MNIFSKDTDKGKHVSGIDRGKIVMYGLSTCVWCKKTKKLLTDLGVDFEYVFVDLLEEEEKSNAIKQVSRFNPSVSFPTTI
    LNDEKAIVGFKEKQIREALGF

    >gi|20090645|ref|NP_616720.1| metallo-beta-lactamase [Methanosarcina acetivorans C2A]
    MQIIPFFVRGIAHSSYILAGKKSCAIIDPQRDVEIYIREAKSRGLKITHILETHLHADFVSGHMDLAELTGAPIYAPEAA
    KCEFEHVGLVEGDTFEIEDMTVKVLETPGHTPEHISYVVSDTSRGPDPTAVFCGDTLFVGDVGRPDLFPGKARELASTLY
    DSLHKKLLSLPDSCEVYPAHGEGSLCGRAMGAKRSSTIGYERKYNYALQIPDREGFIENLTTDMPPAPYHFSRCSEINRK
    GPTKLREIPPPKELPPGEFFRFAGRDNTEVLDSRHYDNFGGEHVPGAWCIDLRSNFATYAGWLLPPERQILLVSDSEKDA
    RESAVWLHRVGLDRIAGFLSGEMFAWATAGLRASHVSQVSIPELYEWVRSKNPPLILDVRASSEYESFHIENALNIQVQD
    LRKRYRELDPEAEYAVI
    CSTGQRSGIGCSILKKHGFSRVNNAAGGMTGYNAAGFGPECPMCALSWAGKAGKKEVVPIQKG
    K

    >gi|20091156|ref|NP_617231.1| metallo-beta-lactamase [Methanosarcina acetivorans C2A]
    MIFERIKSEGLAHLSYLIGSGDEAIVIDPRRDCQVYFDLARSKGMKIKYIFETHRNEDYIIGSLELEKLTDAGIYHGSGV
    DFKYGNILKKDRQEFIFGALKLTALHTPGHTDESMSYVLTDPDAGKEPIMVFTGDALFVGDVGRTDLYGPEEVPRLAANL
    YDSIFNKILPLGDGVILCPAHGAGSLCGGAISNREYSTLGLEKVQNPVLKKTEKEEFVKFKLEEKLEFPPYFKKMEQYNL
    QGPPLLQSLPIPKLLSPDEFKAEMEKGAVVVDTRMPHSFGGALIKGSYSIWLEGLPSFAGWMLPYDKPILLVLEEKEQLE
    TAVRYLVRLGYDNMRGFLNGGIAAWYMEALQIDGFNLLSVHDLKSKLEKDEEIVILDVRSNEEWEEGHIEGARHIYVGHV
    EENLDEIPKDCPIVVY
    CGSARRSNIAASVLKKHGYRKIYNVLGSMVAWKNAGYEVVK

    >gi|20091288|ref|NP_617363.1| cell surface glycoprotein (S-layer protein) [Methanosarcina acetivorans C2A]
    MKGSSIQIISIFFVFMLGPAVTQAGAAVIIVDDSGGGNCSSIQEAVDNAQDGDTILVSPGVYQENIKVDKELTIISHSTL
    AEDRTNRILIIGTVPNNDVFYVNSNSVTIDGFYILGYQSGTDGSEAGIHLEGVQDCSLSNNTLVFNGQGILLNDSQGNYL
    DSNLVNLGDCGIALGDSEDNILSNNIVVTNKQGISLHNSVNNTLVKNIADSNTIGVFLGMSHGNKLAYNHILTNEYGISG
    QAAGHNTLVDNSLYLNGIGVYLNESSDNTLYRNEFINLLNAVDKGNNFWNSSSEGNFWNDHTGKDTDGNGIADTPYLINR
    ATGSIDYMPEVNETLSSNNSENTTKRMSALIALLNKGYSINPRNPEKGTVVEITRLEQINTSLQEGPVFLRIGAEW
    CPLC
    RAMSSTVTELASEYGEKATIMLIDADRNPDFKSYFGVGHIPDFSVIVGIENGEYVYMKSDGNVSKDIDQARLVGIMDKEV
    LEKVLDLALLHERQEKSR

    >gi|20091331|ref|NP_617406.1| hypothetical protein MA2500 [Methanosarcina acetivorans C2A]
    MNKQYLPGFAILIALLIIAPGIAEAVSETDYTETDYTEIDYTETDYTTSVGYQNITPCVASEILEQKCVFILDVRTPAEY
    KHGHIGGAKLIPLKNVPAYDPVNLSDSQLLPNRINELPKNKDIKVFVY
    CKAGNRGAAASQLIADSGYKNVYNIQGGIDSW
    VNGGCPIVFDPTEWTASYPSNL

    >gi|20091692|ref|NP_617767.1| heterodisulfide reductase, subunit A/methylviologen reducing hydrogenase, subunit delta [Methanosarcina acetivorans C2A]
    MRIGVYICHCGLNIAGVIDVSALEAMANELEDVVLAREVQFLCSDSGQEGIIKDIKDNKLDRVVVAACSPRLHEKTFRHV
    MEKAGLNPYLMEMVNIREQCSWVHADDPQMATQKAFDLIRMGVAKARFLRELSATNSKASRNVLIIGGGVAGIEAALNLA
    EAGFPVTMVEKESTIGGKMALMNEVFPTNDCSI
    CVLAPKMTEVQNHPNITLYTYSEVTDISGSVGKFHVRVKRKPRFVLE
    DKCKGCVDLCSGVCPVEIENPMNYGIGKTRAIYMPIPQSVPQVVLIDPDHCVGCGLCQLACPAEAVDYEQKPEEIEFEAG
    AIIVSTGYQLFDASRKKEYGFGKYPDVITNMQLERMLNSAGPTGGRVLVPSTGEPPKSVAFIQCVGSRDKTVGNEYCSRV
    CCMAALKNSQMVKERYPDTDVTIHYIDIRAAGEMYEEYYTRTQEMGVDFIRGKVAEVYSGEDGRPVVRFENTLESSVEEE
    AHDLVVLSTGYEPTKAAEGIGRMLNLARRPDRFFASAHPKMRPVDAPVSGVFLAGCASGPKEIQVSIAQGSACASKVMQL
    LGTGELEADPMGAHVDPDKCIGCRTCVEVCKFGKISIENKKAVVDEVSCYGCGDCSAACPVGAIQMRNFENEQILAQVRE
    ATAHKSQCPFIVAFLCNW
    CSYACADLTGMSRIRYPTNIRVIRTMCSARVNPEFVLEALKGGADGVLVAGCRMDECHYIHG
    NFDAKKRMDILKEVIKEIGLDPKRLRTLWISAAEGERFSNTINEFVKELEEIGPIGSEFKQECAVPGVEEVTQ

    >gi|20091697|ref|NP_617772.1| hypothetical protein MA2875 [Methanosarcina acetivorans C2A]
    MTDKTEMNERMKEMAGELPGVMNAMMGLHSEVVKDGALSARTKELMMVGIAVALRCEPCLWKHVPEAVNLGANRKEIMEA
    VSTAIVMGGGPSVAYGSTVVLKILDEMNV

    >gi|20091786|ref|NP_617861.1| hypothetical protein MA2968 [Methanosarcina acetivorans C2A]
    MKKYDVIVVGAGVSGLLAALTLSKHGKKVLVLEKERHLGGNCNSYMVDGYQVDTGAHAITHLIEGPLPRLMDNYFDFLPV
    FEEYGHYYVRTENAFTKVPSNLKDFVTFDALPRKDRLILSQTLTKALTLSSFGIDLSDQSVYDFLPKNLCKDTYDFVDTI
    SGFLSGKSMKETSAQRILSGSSFVRDSITQEQFDAMIGRLEPKKRQSTESILSSVLPYHLHASLQSRMDRVAQPLASLER
    LATNKVNYSQGYPRKGLKALLNAILYSLPDTVEIKAECEVKSILVQDGKISGVEADEIYPADLVIYTGFATDLPRLIKDL
    PPDYNEELKGIVHTKSLTIWLGLKEELPEFNYTGSEIWFKDFAYWAMPISNYDPSLAPKDKQLVGFSFVINADRTEEHEL
    KKAYDTIFRALPNIEKYIDMQHEQIMVPEKAAVTINGKFADIRTPIKNLYIAGTDTDKRSMGITRASYSIIELLKILNED
    GKLH

    >gi|20091890|ref|NP_617965.1| hypothetical protein MA3072 [Methanosarcina acetivorans C2A]
    MFRPGVLMTKVEKVLLLLKNMVYESTSPQETLKFAKYYRSKGLDVLVILWGPMGVLLAKKDKTRGSPKYDASVQECIEMG
    VEFRC
    CQLASDMIGLKKEELIPGIEFICSKDVAELFLTYREENQLIINF

    >gi|20091946|ref|NP_618021.1| heterodisulfide reductase, subunit A [Methanosarcina acetivorans C2A]
    MTDGLNKAAVFICHCSGNISEHVDIDAVKKTLKAEGISVFDYEYMCSSQGQALIKKKIVEGSLDRVVIGSCTPSKHGTLF
    KKCIQETGLNRAGLEIANLREQCAWVHPDRTGATEKALSLLRAKLKRLENVEPLDEIKVDIAQQALVIGGGIAGITAALN
    LADNGVSTVLVENNSSIGGQMAKIGKIFSPDKLAEECAM
    CSLSPLMNEVAAHPKITLLTRTEVESLSGSAGNFTIRLRKK
    PRYVKDSCTACGRCSRVCPVQVEDEFNCGHMDKKAISLRFSQSVPKIYCIDPDYCLQLNGEACGKCADACKNEAIDFSQK
    EEIVELNVGAVVVATGFEEYDVSQKPQYGYGIFENVLTQMELARVLGINGPTKGELLRVSDFSKASSDPTPATCDSRCED
    SSDESQGTDTPKRIVMIQCVGSRDEKEGGNRYCSRYCCMAALKHASLIKKKHPETEITICYIDVRAFGFYENYYRAVQET
    GVNFVRGRPAEVIEKPDKSLVVRVEDTLDQKMRELPADLVVLSAAMVPSPGTRKIASVLNLSQDESGFIKERHSKLKPVD
    SSLDGIFVCGTAQSPKDVTDTIAQAGLAAVRARAFITDSPKVLDNEIATINQLLCTRCGECLKCPFDALSVNESGRVVLD
    PLICTGCGYCTKLCGEGAVQIAGFTKLQLKAEMEGVLEEGDVLGFVNSGIASLTCDNIGNSVLTYPSNVKLIKVPTGLVV
    DRDLVLHAFRHGASSVLFVEDPPDNPRAEVIYPLTVSHFEELKEELGDSGNRIYFKKAYVPNTKGLAGTFTSLAREGEMI
    R

    >gi|20091970|ref|NP_618045.1| carboxymuconolactone decarboxylase [Methanosarcina acetivorans C2A]
    MGEHEELIEKMSEKLGFTPQILETLGELDPEFLHKYKRCDHKLLSDGALPAKVKIMIALAVVASKQCERCTVVQMQSALK
    NGATKEEIMEVMDVIFITSGAPAVAACRDALKLLK

    >gi|20091996|ref|NP_618071.1| rhodanese family protein [Methanosarcina acetivorans C2A]
    MNKQCMLFFAAILLAFLIISPGMAAASKCTYTNVTACDARQMIEEEDIFILDVCTPSGYDDGQIEGAVLIPLRNLKSDPD
    ALSPDELLPARMKELP
    CNRNTKILVYCKVGKRGAEASSLLVDAGYKEVSNLEGGLTKWVQEGYPIVATYDSWKNVWYLLL
    SPQ

    >gi|20092028|ref|NP_618103.1| thioredoxin [Methanosarcina acetivorans C2A]
    MAGDFMKPMLLDFSATWCGPCRMQKPILEELEKKYGDKVEFKVVDVDENQELASKYGIHAVPTLIIQKDGTEVKRFMGVT
    QGSILAAELDKLL

    >gi|20092502|ref|NP_618577.1| thioredoxin [Methanosarcina acetivorans C2A]
    MASMKKLVLLMILLAVVFFTAGCIDNNWGNSTSSELSQGISTPVKITQLEQINTSLEKGPIFMRMGSKWCPDCRSMKPIL
    EKLAVEYQGNATIAYMDVDQNPELAEYFGAKTIPDSFVIVDIENGTYVYMQKNGKISTDRNQARIIGLSGDSEDDENVFE
    RVLNFALLQQGNNISQ

    >gi|20092523|ref|NP_618598.1| hypothetical protein MA3726 [Methanosarcina acetivorans C2A]
    MGKEQRKPNRLINEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPIFLSIGYSTCHWCHVMAHESFEDEEIARLMNEAF
    VSIKVDREERPDIDNIYMTVCQIILGRGGWPLTIIMTPGKKPFFAGTYIPKKSRFNQTGMTELIPRIKEIWDQQHEEVLD
    SAEKITSTIQNMIVESTGEGLGEEIIEEAYNDLLNSFDPEYGGFGRAPKFPTPHKISFLLRYWKRSGDPEALDMVEHTLD
    NMRSGGIYDHLGSGFHRYSTDNMWLLPHFEKMLYDQALTAIAYIEAYQVSGKDLYKETAEGILDYVLRDLTSPEGGFYCG
    EDADVEGEEGKYYLWTIEEVMSILGPEDSELIIKMFNLKRGGNFEEEIRGRKTGTNLFYMVHSPGSLAAELEIPVEEVES
    RVKSAREKLLKARYERKRPSLDDKVLTDWNGLMIAAFAKGFQVFGEEKYLKAAEKAADFLLETLYGPEKRLHHRYRDGVA
    GISGTSDDYAFLIHGLLELYEAGFELRYLKSAVSLNRELLEHFWDPENGGFYFTASDSEVLIFRKKEFTDAAIPSGNSFE
    MLNLLRLSRLIADPGMEETADRLERAFSKLIKKTPSGYTQFLSAFDFRLGPSYEVIISGKRESPDTVNMLEELWSYFTPN
    KVLVFRPEGENPEIADLAEYTKEQLPIEGKATAYVCQNYECQLPTTETREMLKLLNV

    >gi|20092534|ref|NP_618609.1| carboxymuconolactone decarboxylase [Methanosarcina acetivorans C2A]
    MTEHEEILESMGEKMGFTPQVLETLGDLDPEFLHKYRRCDHKILTDGALPSKVKILMALAVVASKQCESCTVAQMKSALK
    NGATKEEIMETMEVIFITSGAPAVAACRNALKMLKDM

    >gi|20092579|ref|NP_618654.1| arsenite S-adenosylmethyltransferase [Methanosarcina acetivorans C2A]
    MDAAEKKEVIKKKYQEIATLGGSCCSGGGCCGDLSAADLSRSLGYSEADVQAVPDANLGLGCGNPTAFAELKPGDIVLDL
    GSGAGFDSFLAAQRVGSLGKVIGVDMTQEMVKKAQDNARKYGYSNVEFRQGDIEALPLDDRSVDVIISNCVINLAPDKEK
    VFREAFRVLKPGGRMYVSDMVLLEDLPEDLKNDCDLLAG
    CVAGALLKEEYLGLLKKAGFSFKILAEDSDVSKRQYEGLPV
    ESLKLKAWV

    >gi|20092722|ref|NP_618797.1| hypothetical protein MA3926 [Methanosarcina acetivorans C2A]
    MEEILKTLTIVLTGGPYISEYAEIAFKLAEEALKQYQVNIFLYLDAVHIPKKGQKPSFFTNAGELFIGLAEKGAVIRACA
    RCAAARGYIAEEGLENESNCRDYIPGIKISSLYELSEMLSKSDRVISLSR

    >gi|20092734|ref|NP_618809.1| hypothetical protein MA3938 [Methanosarcina acetivorans C2A]
    MRIEVLGSGCAKCNKTKELAEKAVKETGVDAEIVKVEDFDKILEYGVMVTPALVIDGDVKIAGKVPSVEDIKKWITK

    >gi|20092738|ref|NP_618813.1| hypothetical protein MA3942 [Methanosarcina acetivorans C2A]
    MKNMKIEILGTGCAKCKKTKEAIEKVLAETGKKAEVVKVENIETILNYGVMVTPAVVVDGEVKLAGKVPDEKEIRKWVE

    >gi|20092742|ref|NP_618817.1| carboxymuconolactone decarboxylase [Methanosarcina acetivorans C2A]
    MPFMNEILPDTAEAFGKLRDSIFEGGELDRKTKELIAIASSVLMRCQYCVDVHSQRAAANEASKKEIAEAIAVAMFIAGG
    SQLGWTNVYGENVYDIVFGEKKPEEAEKEKGCCCGNWRRNQRNS

    >gi|20092749|ref|NP_618824.1| 4-carboxymuconolactone decarboxylase [Methanosarcina acetivorans C2A]
    MSFLNEMLPETAEAFGQMRNSIFKDGFLDLKTKELIAIASSVLMRCQFCVDVHSQRAAAAGAAKEEIAEAISVAMFVAAG
    SQIGWTNVYGENVYDKIFEKDGEEEDCCCCCED

    >gi|20092786|ref|NP_618861.1| carboxymuconolactone decarboxylase [Methanosarcina acetivorans C2A]
    MWWFLMELEDIVEVLKNDPEKVIPELLEDVRKQYGEVPYIMNFMKDLPEIFIPKTIYDNSIMREFKNLDPETVELISIGV
    ASALRCGH
    CLKMHIRIAKRKGIPKEKIFSAIMIGASLSNAAVLAESTRALASEFPGDEKGSEENEHCCDPDCEVCNIAGA
    NIK

    >gi|20092808|ref|NP_618883.1| glutathione reductase (NADPH) [Methanosarcina acetivorans C2A]
    MEKEYDIIILGTGTAGRTLAGRAKSSGLKFAIIDSREYGGTCPLRGCDPKKVLAGASEATDWNNRLIGKGAGTEKPLEIN
    WSSLIEFKRTFTRDYPRETEKMFADMGIDMYHGRANFENENTILVGKDKLKGKYIFLATGSKPRKLNIPGEEYLITSEEF
    METEKFPEKIIFVGGGYVSFEFAHIALRAGAEVLILHRSEKPLRDFDSEMADLLVRASEAAGMRILTDRPVVAVEREGDR
    FLVRAEYKTETGSETQTFNADMVVNGAGRTPDIEDLRLENAGITAEKKGIIVDKHMQTSNPRVYAGGDCTAEGMQLTPVA
    TLQGEIAAANIFDENRAEIDYTGIPSAVFTIPVLASVGITEAKVNDKHRVIFRDRSKWSTTRRAGLEFAASKIIVDETND
    HIVGAHILGPNAEEAINIFATAMQLGLRASSIKKMAFTYPTTCSDIRYML

    >gi|20092861|ref|NP_618936.1| bacterioferritin comigratory protein Bcp [Methanosarcina acetivorans C2A]
    MAKTSLESGQPAPDFCLPDQEGNRTCLEKLRGKWVVLYFYPRDNTPGCSLEAKNFSCLKKDFEAENAVILGVSRDSEESH
    RKFIEKKELKIKLLSDEHAEVHGKYDVLHPKHFRGKDVISAVRTTFLINPEGIILKVWDNVKASGHAEKVLSELQKLKET


    >gi|20092865|ref|NP_618940.1| 4-carboxymuconolactone decarboxylase [Methanosarcina acetivorans C2A]
    MMDITEMNERMKEMAGELPGVMKTMMGLHSEVVKDGALSARTKELMMVGIAVALRCEPCLWKHVPEAVNLGATREEILEA
    VSTAIVMGGGPSVAYGSLVVLKILDEMDI

    >gi|20092896|ref|NP_618971.1| peroxiredoxin [Methanosarcina acetivorans C2A]
    MPLIGDDAPSFTAVTTQGMINFPEDYKGKWVILFSHPADFTPVCTTEFMTFASMQEEFREMNTELIGLSIDSVFSHIAWL
    RRIEEKIEYKGMKNLEVKFPVIEDLKMEVAKKYGMLQPKTSTTQAVRAVFIIDPEAKIRTILYYPQSTGRNMQEIKRIVI
    ALQKNSAEKVATPANWQPGDDVIIPPPNSMEAVKERLGTEEEGKCCLDWFLCLKKDSKK

    >gi|20093044|ref|NP_619119.1| thioredoxin [Methanosarcina acetivorans C2A]
    MNKLIIPLILLASVIFTAGCTESPESATSAQEISVVENMTSLEQINTSVQEGPVLIKVGAEWCGPCQQMKPILSDLAAEY
    TGKVTVMSADIDQSPEIAAYFGIAYIPDSFVVVGFENGEYVYMQEDGNVTTDRFQARVLGVRDKQVYEELLERAVLYYEN
    K

    >gi|20093111|ref|NP_619186.1| methylated-DNA--protein-cysteine methyltransferase [Methanosarcina acetivorans C2A]
    MYYAIFESPIGPILLAGDEEGLKYVNFMKGKKKIEVPDSWVENEEFFREASRQLEAYFAGELKSFDVKLAPEGTEFQKSV
    WNALKEIPYGETRTYGEIAKNIGNPKASRAVGLANNRNPIAIIVP
    CHRVIGANGKLTGYASGLDIKEFLLKLEGSC

    >gi|20093306|ref|NP_619381.1| hypothetical protein MA4521 [Methanosarcina acetivorans C2A]
    MILNKVAVDRKRDDKVILNKVAVDRKRDEKLIINRVAVDQFSETLQKARNDPSKTKKVIEFEGNWEIGKTGPQFSTKIKT
    EKGGEFLIQSDEPIALGGSGTAPNPVQYGLYGIAS
    CFAASLAKWTAMEGIVLNQLKIKVRADMDLSASFGIFQEPAIPIY
    ECIKFEIVIDSGMSMEEIKRFNEIAKQRCPCYYCLTAAIVPDIVFKKGDQNHKQVSFL

    >gi|20093415|ref|NP_619490.1| NADH dehydrogenase [Methanosarcina acetivorans C2A]
    MGSDFSVKDAAGKIMQPAAEVQEEVPGKGPIHVRTEKEITRVVIIGGGACGMAAATKIRRQSDFKITVLSSDSHTAYSHC
    GIPFVLGREIENFEKLIVKPPGFFREKNIDVKLNEKVMSINLAKRVVLTGKGTYPYDKLVIATGSLPFIPRKSKANILPY
    GIFTLRSLADGKLFGKALETAQTVCIIGGGIIGIECASALTKRGIKTILITRSKDLLSSQFDSDMAAIVRAHLEALGVRV
    ITGEPLFLPENFWKEKTVYIKDRHFPADLMLLATGVKPEVCLASEAGIDTGKAGGIVVNEMLQVKAGGEFLPNVYAGGEC
    AEVTDLLTGESRLSPLGTTARRMADVIGNNITDKYSTFGPLADPWVAVAGDLQFGGVGLTPEQVKRQGIKVVSGFSRGRT
    RASYYPGRKDIYIKLFFKDGCLAGAQLAGGEGIKERIDALSLAIRKKTTIKDLLNLETCYAPPVSMLVDPLTPAVKAAVR
    NIRKAKTE