Methanosaeta thermophila PT uid58469

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116753418|ref|YP_842536.1| carboxymuconolactone decarboxylase [Methanosaeta thermophila PT]
    MCGCGDRHGEIMRSLGDKMGGYVPETLKAIYDHRPELMELIERLDRVLLEDGALDKKTKRLIALACVITRMCEDCVYPQA
    KVAVNYGATKDEILETLEICMITGGVPTFSIAKNGISRLFKEMEE

    >gi|116753806|ref|YP_842924.1| alkylhydroperoxidase [Methanosaeta thermophila PT]
    MLEDELKGILEKGVERSAEDMIKTIEEIYGEVPYIFHFMKDSPELLVTKILHNNAIVRNSKLDMKTIELISIAVSAAIRC
    SH
    CLEMHIRVASRMGISDEEIAAAMFLAANLVNASVLATATRELDEEREVCRACQVGTCEVHEKK

    >gi|116754000|ref|YP_843118.1| beta-lactamase domain-containing protein [Methanosaeta thermophila PT]
    MLFERIVSEGLAHYSYIVGDYGSAIVIDPRLDCDVYVDIASRNKMRITDILETHRNEDYVTGSVELSALTGASVWHADPE
    LDYRYGAPAREGQVWKIGAWQIEAMPAPGHTLGSMAYVLKDHAGVPHAVFTGDAMFAGDVGRVDLLGMDRAEELAGMLYE
    SIFQRILPLGDGVLLCPAHGPGSACGSAITDRPWTTVGMERLHNPKLRAGSRNEFIRSVALELERPPYFRRMEDLNLKGH
    RLKRRAISPLTPEEVAEALDECVIVDTRSDVAYGGAHIPGSQFIWADGLAALAGWYLSYDKPVILVGDEIERASRTLMRM
    GYDEISGYLGGGMLAWHMAGHESSSIRTVTVQELCRHLDQGGQAWILDVRSEEEVSKESITGAHHIHVTQLPRRMDEVSK
    EKAVYVF
    CGSGMRSMVAASFLRRHGWRNLAVVLGGLSGWKSVTCPVVRQV

    >gi|116754001|ref|YP_843119.1| rhodanese domain-containing protein [Methanosaeta thermophila PT]
    MREYPYPSKSDVRWISPDWLDENMDDVRIIDVQPNVHDYIMGHIPGAVYMNEGILRVARGRQPASFVPPESIESVFSSMG
    ISRDVPVVVYSGPGVYSRCAAGIGDGLEQTMVAYALIRFGHQMVHILDGGIEGWMESGRKLTKEFPDVLESRFRAEIRCE
    HFVGMYELRSMMEGEDIILFDARPTPSYEGQAMWIKPGHIPGAHSLPWRNLMTEKNSRLLRSDVELRSMISGFDLDNKKI
    IVY
    CGTGREATNEYLFFKYYLGHPDVRIYEGSFTEWSSYQENPTVTGPNPR

    >gi|116754003|ref|YP_843121.1| redox-active disulfide protein 2 [Methanosaeta thermophila PT]
    MKIEVLGTGCAKCKGLENNVRQAVKEMGIDAEIVKVDSIMEIMDRGVMMTPALCIDGETVAVGRVLSVEEIKGLLKG

    >gi|116754019|ref|YP_843137.1| glutaredoxin [Methanosaeta thermophila PT]
    MRCLTCRIYTTPDCPRCEQLKAFLESKGVSFEEVDMTTAEALTELRVNGVFTMSAPVLEMDGRFYTTGDLFDGDRLKELK
    L

    >gi|116754023|ref|YP_843141.1| thioredoxin [Methanosaeta thermophila PT]
    MDELDEIRRKKLEELKRELAARSQGTPTIEYPDRPVLVTDSSIDAGIRQYPVFVVDCWAEWCGPCRAIAPVIDEMARELK
    GRVVFGKLNVDQNPLTSRKYGITAIPTLLVFRNGRLVDRLVGAYPKQILMSRVRKYLD

    >gi|116754094|ref|YP_843212.1| alkylhydroperoxidase [Methanosaeta thermophila PT]
    MRKARADRFLDSVDTGVSRAFRSLASMILGDGALSAREKALIALACSVAIRCEDCTRRHMEQARALGATREEMIEAAAVA
    SLIRMGSGLNTAAVILEEMDDAAANQR

    >gi|116754213|ref|YP_843331.1| dihydrolipoamide dehydrogenase [Methanosaeta thermophila PT]
    MDDKYDVIVIGSGAGLIVAQRALFEGLRVALIEHGPLGGTCLNTGCIPSKMLIHPADIVRMVEDGSRLGIKAHVDSIDFE
    FIMKRMRDLIEAERGEMEKAIGEEEQLRWYRSTGVFVGDHLIRVGEEEITAPWIVIAAGARTLVPPVAGLGEAGYLDNVS
    VFSLAKPPESLIILGGGYIA
    CEFGHFFSAMGSDVTIVGRNPRLLKSEDHEISDMALKALSKHMRIHTNMEAIRVDLEGGK
    KVVTAIDRSRGETVSFVGDEILLAAGRRPNTDMLQPEKSGVEIDRAGWVRVNEHLETTAPGIWALGDITGKHMFRHTANY
    EASIVAHNLINAARGEKEKVKVDYHAVPHAIFTYPQIAGVGMTEEQARANGYDILVGRAYYKQTAMGYAMDEDGMAKAIV
    DARSGRILGFHVIGSSAPELVQQVTYLMNAENQDVTPMARSQVIHPAISEVVARAFGNLRGE

    >gi|116754215|ref|YP_843333.1| heavy metal translocating P-type ATPase [Methanosaeta thermophila PT]
    MRKRAEIRISGMTCATCASTIESALREKGVESASVNLGSETAHVEYDPSRLKLSELERAIRDAGYDVINERATVKVGGMV
    CATCESTVADAIREIDGVSDVTVNLSTEKAYVTYNPKVVSLDDIRRAVEDAGYQYLGVVGEESESLEAEIRARDLRERMR
    KIIVGFGASALLMALMYLAPMTHTMSIVMMCVATPAFVYVSSGIFRAAHRALRNRNLNMDVMYSMGTGVAFVSSVLSTFR
    ILSHDFIFYETAVMLASFLNLGRYLETRAKWRTSDAIKKLVALQPRTATLIVDGSEKEIPAEMVKPGDIILIRPGERVPA
    DGEIIEGEGYVDESMISGEPVPVLKKPGSQVIGGTLNKNAALKMRAMRVGRETFLAQIIDLVDKAQGSRPEIQRLADRVV
    GVFIPIVLSIAILSFLAWYFFGRSYLPEDRILMFAISSMISVLVVACPCALGLATPTAVTVGIGRGAELGILIKSGEALE
    ASDKLTTVIFDKTGTLTVGRPEVTEIVGDERMLRLAAGIESRSEHPLGEAIVRMAISKGIDIPETKDFYAFPGMGVVGVV
    DGVEVAVGNRSFISERGTRIPDDMLERASALEELGQTVLFVSVSGAAAGAFAISDAIKDSAKAAVQKLKSMGLDVVMITG
    DNIRSARSVAEQIGIEEVHAEVLPQDKASEVRKLQQAGRTVAFVGDGINDAPALAQADLGIAIGSGTDVAIEAGEIVLIR
    DDLMDVVRGIQLSRKVMSRIKQNIFWAFAYNTALIPVAAGVLYPGFGITFRPELAGFAMALSSVTVVSLSLMLKRYIPDV
    QK

    >gi|116754218|ref|YP_843336.1| glutaredoxin [Methanosaeta thermophila PT]
    MGKVHVDGHDAGAVTLYALSTCMWCKKTRDLLSKLGVSYDYVYVDLTSGAERAELIDELRKFNPDLTFPTLVANGRVIIG
    FKEKEIMSALGAL

    >gi|116754377|ref|YP_843495.1| rhodanese domain-containing protein [Methanosaeta thermophila PT]
    MLLDVSEEAESHIPGAVHINYTDLCGEDEILKPPEDLARIFGKAGISDSDSVVIYGECRPCGGSGVTIHPSTLTYFALLY
    LGHRNVWLLDRGITGWTNAGMPTASETSKRPPAVYTPHPRGGLLASIDYIKNSDVQLVDARTVQEFEASTILGSINIPAD
    TVVSGGWFREDSELENLFRAKGLTKEKPVVVFTSTGVKATVVWFALKRMGYDARLFAMRRWVGAGETIVKP

    >gi|116754411|ref|YP_843529.1| cytochrome c biogenesis protein, transmembrane region [Methanosaeta thermophila PT]
    MHSRRSAADNTIRNALRTLVPALALFLFVYPAACEDVLILTAPGCAKCAAAHSVLEDVLSSYEDVHIQEHTYTSEEGRKI
    IKEFRVKDIPSIIIDGSVIGYRDYDGNESRLRELIISALEGRIRTNASSEMPYPSELFESITLSTALTVLIAGLLAGFNP
    CLLAILAFLATTVLSSTGRRRDMLSMIIFFSLGILSVYLIVGMGLFRVMQNTDTASMLRLVLSMLLILLGMLQLEDARRL
    GSSGRSLFRTDWILSYFQAAAGAQSLAAYFLLGMLFSMVKAPCVGAVYVAIITMIYTKGYASSAIAYLFLYNLGVVLPVM
    LLGGAIALGMQPESVERFRHEHRVAIRIITGLTLIALAPLIYLEII

    >gi|116754438|ref|YP_843556.1| thioredoxin [Methanosaeta thermophila PT]
    MISFEEVEDLDKPVLMDFFAEWCGPCRMQTPIMEELDKKYGGRIEIKKIDVDRNIELANRYNIMVVPTIILEKDGKEVRR
    WLGVTSKEELSSAIDAIL

    >gi|116754454|ref|YP_843572.1| thioredoxin-disulfide reductase [Methanosaeta thermophila PT]
    MYDVIVVGAGPAGLTAGMYCARGGMKTLILGNVYTSQQSMGGLYENYPGFPDGIQGIELSERMLSQAQKYGAEYRQEMVE
    KIVHLDDTFRIKTESWEYVCRALILATGASHRKLGVPGEEKYVTRGLSY
    CVYCDGALFRDRTTAVVGYGNGAARALLYLS
    NICSRVHLLCPRERLVAEAVYLDRLKGINNITQTFGVEVTRITGDEFVSGIEFVVGGTPRSLKVDGIFVEMGVSPNTKLA
    EDLGLELTEGGFVKVNRLTQETSMPGVFAAGDVTGGRMQVATAVGSGASAAISAMRYIR

    >gi|116754467|ref|YP_843585.1| glutamate synthase (NADPH), homotetrameric [Methanosaeta thermophila PT]
    MSPRVKMPKQTPELRRRNFSEVALGYSKEDALREADRCLGCKKPGCVEGCPVGVEIPQFIDALRRGDADEALRIIKRRNS
    LPGICGRVCPQEEQCESRCVLARKDEPIAIGRLERYAADFGRDCRRARESTKGKRIAIVGSGPAGLT
    CAADLALMGHDVT
    IFEALHEAGGVLTYGIPEFRLPKSIVKREVDYVRSLGVKIELDAVVGRTVGVQDLLREYDAIFLGIGAGAPRFLNIPGEN
    LGGIYSANEYLTRINLMKAYMFPDFDTPINKGRKVAVIGGGNVAMDAARSALRLGAVEVHIVYRRSEAEMPARLEEIENA
    KEEGVIFDLLTNPVAFEGDGMVRAMECVRMELGEPDASGRRRPVEKKGSEFTMEIDTAIIAIGTTPNPLVLRSVPGLRTT
    RWGTVDVDERGRTSIERIWAGGDIATGSATVISAMGAGKRAAFDIDSWLRDGGEWRP

    >gi|116754580|ref|YP_843698.1| NHL repeat-containing protein [Methanosaeta thermophila PT]
    MMQICKTAMNPPATTRVICTQSRANPMIAPEFPEDLVWLNTDRRYTLRDLRGRFVLIDFWTYCCINCMHVVTDLKMLEER
    YPELVVIGVHTAKFENEMRVENIEKAIMRYGIEHPVIVDSDRTLWRAYGIRAWPSFVLIAPDGEILGRTSGEGIFSILMP
    IMEQLIPEYEKRGSLHHGKPAPRATHKGVSGALSFPGKVISGGDNIFIADSNNNRILIVSPDGDLMDVIGSGERGYSDGD
    FSEARLFRPQGIAIVGDVVYIADTGNHMVRAADLRRRTLVRMAGTGKSRHPGLGGRGAEVSLSSPWDLVFVQDHLYIAMA
    GSHQIWRMDLEGMVEPYAGSGIEGLADGPLEQARLAQPSGLTTDGNRIYFVDSESSSLRVIDGDVRTLIGRDLFYFGDID
    GDFGRARLQHPLGLFYKEGSIYVADTYNHRIKKADLSSGSIHTTAGTGSPGFADGPGAQAAFNEPSGLTFLGDSLFIADT
    NNHAVRIYDQRSGDVSTMRIDTKK

    >gi|116754587|ref|YP_843705.1| DsrE family protein [Methanosaeta thermophila PT]
    MKTLTIVLTDGPYINQNAEIAYRIARAALERYRVNIFLYLDAVHIPKRGQRPVQFRNIGGLFHELASLGAIIRACPRCAS
    SRGYASENGVCPEYIDGVLITSLYDLERMIRESDKVISLSG

    >gi|116754713|ref|YP_843831.1| peroxidase [Methanosaeta thermophila PT]
    MSCTADMDEGMPLLGDRLPRMEVRTTHGPITLPDDLAGKWFVLFSHPADFTPVCTTEFIAFQKRREDFKKLNCELIGLSV
    DQIFSHMKWTEWIREKMGVEIKFPIIADTGEVADLLGMIHPGKGSNTVRAVFVVDPSGIIRLILYYPQEVGRNIDEILRV
    VEALQVVDKNKVATPANWPNNDLIGDEVIIPPPSDEKSAKERLSMYDCYDWWFCHKKISR

    >gi|116754726|ref|YP_843844.1| methyltransferase type 11 [Methanosaeta thermophila PT]
    MFDMLGEREIKKAVRDGYSRIAMQATCCSGSCCGTGSAAEISRRIGYTDEEMLSAPPESNLGLGCGNPVAIASLKRGEYV
    LDMGSGAGFDCFLAARAVGPEGMVIGVDMTSEMVDRARENARKGGYRNVDFRQGELENLPVADNYVDVIMSNCVINLVPD
    KRRVFREAFRVLKPGGRLIISDIVLKREIPEAVRRSKEAYVG
    CLAGAVTVEEYIDAMRSAGFEEISILGESPFPVECLPA
    NITKVDLSESVCSMRISARKPA

    >gi|116754810|ref|YP_843928.1| methyltransferase type 11 [Methanosaeta thermophila PT]
    MYTWDPEEYERCSSAQQEWAMSALSELSIRGDERILDIGCGDGKITARISQLVPDGSVLGIDISPDMISFARRRYSPVIF
    RNLRFEQGDALDLRFDEEFDIVVSFACLHWIRDHLSVLQGIYRSLVPGGRMLVQCGGRGNAAQLLDTTSEV
    CLEESFASY
    FKDFQFPYFFYEPDDYEMWIPAAGLHTVSVKLIPKDMVHSSREALEGFLRSTWHPYLQRLPVELRSPFVQEIARRYIDRY
    SSPDGMIHVRMMRLQALAEKQPD

    >gi|116754817|ref|YP_843935.1| methyltransferase type 11 [Methanosaeta thermophila PT]
    MYTWDPEEYERCSSAQQEWAMSALSELSIRGDERILDIGCGDGKITARISQLVPDGSVLGIDISPDMISFARRRYSPVIF
    RNLRFEQGDALDLRFDEEFDIVVSFACLHWIRDHLSVLQGIYRSLVPGGRMLVQCGGRGNAAQLLDTTSEV
    CLEESFASY
    FKDFQFPYFFYEPDDYEMWIPAAGLHTVSVKLIPKDMVHSSREALEGFLRSTWHPYLQRLPVELRSPFVQEIARRYIDRY
    SSPDGMIHVRMMRLQALAEKQPD

    >gi|116754824|ref|YP_843942.1| methyltransferase type 11 [Methanosaeta thermophila PT]
    MYTWDPEEYERCSSAQQEWAMSALSELSIRGDERILDIGCGDGKITARISQLVPDGSVLGIDISPDMISFARRRYSPVIF
    RNLRFEQGDALDLRFDEEFDIVVSFACLHWIRDHLSVLQGIYRSLVPGGRMLVQCGGRGNAAQLLDTTSEV
    CLEESFASY
    FKDFQFPYFFYEPDDYEMWIPAAGLHTVSVKLIPKDMVHSSREALEGFLRSTWHPYLQRLPVELRSPFVQEIARRYIDRY
    SSPDGMIHVRMMRLQALAEKQPD

    >gi|116754837|ref|YP_843955.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanosaeta thermophila PT]
    MRSSPRLVIVGGGIAGAELIRLLSNTEIEISLIEPKHQIECQALYPDYLAGLVGIDDMIAPLDDFCERSGALHISERALE
    LDDGVVVCQRSRVEYDILVIAVGAEQNFYGVKGSENAFSVNTFEGTLHAREFIERESPDRIMVVGSGLTGVEVASVLADS
    LESNIYIVEMQGRILPQFPERISRLVERILFERGVSILTSTQVSEIQRDSITFADGTTLDCDMTIWTTGIKPTQFAENLR
    FPKKRGWLLTDPYLRVQDDIFAIGDCAWIEIDQKLATKTGIEAERQAKHMAENLKRMIRRRSLTQYSILACTENPIALIS
    TGCGRAVGVYGRTCIPLPARLLRAVKIWIDKSIVSRYK

    >gi|116754868|ref|YP_843986.1| methyl-viologen-reducing hydrogenase, delta subunit [Methanosaeta thermophila PT]
    MDRSPMRIGVYICHCGLNIAATLDVEELRRFAETLPNVVVARDIQFTCSDAGQNTIKSDIAELKLDAVVVAACSPRLHEP
    TFRRTITEAGLNQYMLEMANIREQCSWVHMDSPALATQKAKDLIAMAVAKASLLRPLETESVPVSRDVLVIGGGVAGISA
    ALDLANAGLRVYLVERRPTIGGYMALLTDVFPTNDCSI
    CVLAPKMAEVYANPMIKLMTYSEILAIEGTVGHFRVTGVTKP
    RYVDPTLCKGCINECSSACPVEVPNEYDFGLGKRKAIYMAIPQSVPLVACIDTNACIGCGLCAEACPADAVKYDQQAEEF
    KLDVGAIVVATGWQPFDASRKEEYGFGRYRDVVTTLQIERMLNAAGPTRGDIVRPSTGEIVRSVAFIQCVGSRDQTVGNP
    YCSRICCMASLKNAQLIKERYPDADVSIHYIDIRAGGEGYEEFYLRAQRLGINFIRGRVSSVEEGEDGLYVHYEDTLLGK
    TLMKRYDLVVLSTGLEANSDADVVGNLLGLSRRPDRFFEIAHPKMRPVEAHIDGVFIAGCASGPKEIQVSIAQGSAAASK
    AMQLLFKGEIELDPTVAFVDRDKCIGCRLCVDTCPSRAISVKDTAFVDEARCKGCGTCAAACPVDAIEMRLFSDEQILAQ
    IRAATTVKGEYPFILGFLCNW
    CSYAGADLAGTSRIQYPTNIRIIRVMCAGRVDPSFVLEALRRGADGVLIAGCRIGECHY
    VSGNLHALQRVEVLRGLLKEIGIDPRRLKVAWCAASEGDILARRIEEFVEELKDLGPVGTELAAALPSGKV

    >gi|116754881|ref|YP_843999.1| methylated-DNA--protein-cysteine methyltransferase [Methanosaeta thermophila PT]
    MSEGTVKRIRLSRASPDLEFSEMAARIAEHIRGGPRPDLDLDLSWCTDFQMAVYRAVLNIPRGSTATYSDVAKIAGRPGA
    ARAVGAALRVNPFPIMIP
    CHRVVASNGPGGYSQGIDIKLQLLAIEQHEMSREQRSFARIG

    >gi|116754985|ref|YP_844103.1| hypothetical protein Mthe_1697 [Methanosaeta thermophila PT]
    MDRKPNRLAGESSPYLLQHAYNPVDWYPWSPEAFERARAEDRPIFLSIGYSTCHWCHVMARESFEDERIAEMLNRAFVCV
    KVDREERPDIDAIYMEACQIITGRGGWPLTIIMSPDGIPFFAATYIPKDGRLGMMGLRELIPLVEELWRNRRSELTSLGF
    KVLNAMRKADTHLQASNADESTLSRAYLELSGIFDWTSGGFGRAPKFPLAQNLLFLLRYWHRTGEMKALEMVELTLREMR
    CGGIYDQLAYGFHRYSTDSSWGVPHFEKMLYDQALMSVVYLEAYQATGKRDYAIVADEILGFVAEDLRSPDGAFCSALDA
    ESDNIEGGYYLWTMDQLRDALGDDLKKALEVFVLEPIGGSDGKNVLRISLKGELSEFKHTSEPIRRKLLDARSLRRKPFR
    DEKVLADWNGLMIAAFSRGAQVLGDERWLRIASEAADFVLSSMHRDGMLMHSYKGSRVSILDDYAFLIFGLIELYQAGFD
    GRYLERAEILCDEMVSHFSDPDGGFYYTMKEQSDIILQRKEIRDGAIPSGYSMATMDMLLLGKILGRPDLEEIASMSLRH
    ISMASLPAQVGLLIALDLALGPSHEIAIVGDADNTRTMLRALWSVYAPRKVVVSGDRPPEWASSLRPVDKKATAYVCSRY
    TCSFPATDIRSMIELLDVRELRSSENASG