Archaeoglobus fulgidus DSM 4304 uid57717

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|11497804|ref|NP_069026.1| hypothetical protein AF0187 [Archaeoglobus fulgidus DSM 4304]
    MAKLLYVQTSGIDTPERLYAPFVLAMTAKAMGDDAIIYFVIKGVTVVKKDNAEKIKMGNFPPLSELMKQARESGVEMMVC
    DRSSELLGIDKGEIVDGVKIVGAATLNQLVLEADGVLYF

    >gi|11497870|ref|NP_069092.1| NADH oxidase (noxA-1) [Archaeoglobus fulgidus DSM 4304]
    MKVAIIGGGAAGMSAASRVKALRPNWDVKVFEKSRWVSHAPCGIPFFVGGAVEKFDELCAYDIDYFKRERGIDVHTNARV
    VEIEEGRLTVDEGGKEASYEWDKLLFATGSKAVRLNVEGENLEGVIYVDDIENAERVKIEAMKVDNVVVVGSGYIGVEMA
    DAITRLGKNVTVIEVMERPLPEYDAEIAAIIKSEMEKYVNLRLSEKVTAFEGKDRVEKVVTNKGEYPCELAIIAVGVAPN
    TDLAKGFVELGVKGAIRTNSRMETSRENVYAAGDCAESINIVTGREDWIPLAAPANKMGYVAGVNMAGLEMHYPGSLKSQ
    LTGFKDIEIGKAGLSENEAIRFGYEVVSAFITSRTSARYLPGGLIHLKVVADRNGKLLGLQAVGKDVAMRVYAASALLHK
    NGDVKDLFFCDFPYYPPVSRVWDPLVVAARNIFRKLGLP

    >gi|11497886|ref|NP_069108.1| alkyl hydroperoxide reductase [Archaeoglobus fulgidus DSM 4304]
    MKLPEAFKGKWFVLFSHPADFTPVCTTEFVAFQNRYDEFRKLNCELIGLSIDQVFSHIKWIEWIKEKLDIEIEFPVIADD
    TGRVAEMLGLIHPAKGTNTVRAVFIVDPEAVIRAVIYYPQELGRNMDEILRAVKALQVSDQNGVAMPANWPNNELVGDAV
    IIPPPISEAEAKERLEKAKAGDISCYDWWFCYKKI

    >gi|11498007|ref|NP_069231.1| NADH oxidase (noxA-2) [Archaeoglobus fulgidus DSM 4304]
    MRVVVIGGGAAGMSAASRVKALQPEWEVTVFEETNFVSHAPCGIPYVVEGLSDPSHLMYYPPEFFREKRGIDLHINAKVV
    EAGDGFVRVIEDGQEKTYEWDKLVIATGALPKTPPFEGLELENVFTVRHPVQAAELREAVEKAENVVIVGAGYVGVEMAE
    AAAARGKKVTVVEFLDQPLPNLDRDVADLVKHKLEEKVNLRLGEKVEAFEGDGAVRKVVTDKGEYPADVVIVATGVKANT
    AIAEQIGCKIGETGAIWTDSRMQTSVENVFAAGDCAETTHMLTKKRVWIPLAPPGNKMGYVAGVNAAGGNIEFPGVLGTQ
    LTKFFDLEIGATGLTEKAAKAEGFEVKTAVVKAKTRVHYYPGAKDTFLKVVADASTKRILGAQVLGADVAMRVNVFAAMI
    QGGFTTKDVFFADLGYAPPFTPIWDPIVVSARILKF

    >gi|11498012|ref|NP_069236.1| NADH oxidase (noxA-3) [Archaeoglobus fulgidus DSM 4304]
    MNVVVIGGGAAGLKAASRIRRKDGDASITVVEAGKYVSLGRCGLPYYVGGLVHEVDNLRETTYGAVRDEAYFKKLKNIDV
    LTETVATEIDRSRKTVKIVRNGSEDELNYDYLVIATGARPAKPPIEGIEAEGVVTLTSAEEAEKIIEMWEEGAEKAVVIG
    AGFIGLESAEALKNLDMEVTVIEMMDRVAPAMLDREMAVLVENHLREKGVNVVTSTRVEKIVSQDDKVRAVIANGKEYPA
    DVVVVATGIKPNSELAEKAGLKIGETGAIWVDEYMRTSDESIYAGGDCVETTCLVTGKKIIAPFGDVANKQGRVIGENIT
    GGRAVFPGVIRTAIFKVFDFTAASAGVNEQMAKEAGLDYFTVIAPSPDRAHYYPQANYIRLKLIVEKGSWRVIGAQGVGM
    GEVAKRIDVLSTAIQAGMTIDQLANLDLAYAPPYSPALDPVITIANVAMNKRDGLFEGINVFELKEKLEKEDIVILDVRS
    EEEFKTRRIESEKVIHIPILELRERLDEIPRDKEIVVV
    CAIGLRSFEASRILKHAGFEKVKILEGGMAFWF

    >gi|11498084|ref|NP_069309.1| cation-transporting ATPase, P-type (pacS) [Archaeoglobus fulgidus DSM 4304]
    MVKDTYISSASKTPPMERTVRVTGMTCAMCVKSIETAVGSLEGVEEVRVNLATETAFIRFDEKRIDFETIKRVIEDLGYG
    VVDEQAAVSAEVEHLSRMKRKLYVAAFAGVLLLFLAHFISLPYEDFVQLLIALPAIFYSGSSIFKAAFSALRRRTLNMDV
    MYSMGVGAAFLASVLSTAGVLPREYSFYETSVLLLAFLLLGRTLEARAKSRTGEAIKKLVGLQAKTAVVIRDGKEIAVPV
    EEVAVGDIVIVRPGEKIPVDGVVVEGESYVDESMISGEPVPVLKSKGDEVFGATINNTGVLKIRATRVGGETLLAQIVKL
    VEDAMGSKPPIQRLADKVVAYFIPTVLLVAISAFIYWYFIAHAPLLFAFTTLIAVLVVACPCAFGLATPTALTVGMGKGA
    ELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNGDERELLRLAAIAERRSEHPIAEAIVKKALEHGIELG
    EPEKVEVIAGEGVVADGILVGNKRLMEDFGVAVSNEVELALEKLEREAKTAVIVARNGRVEGIIAVSDTLKESAKPAVQE
    LKRMGIKVGMITGDNWRSAEAISRELNLDLVIAEVLPHQKSEEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVGSGSD
    VAVESGDIVLIRDDLRDVVAAIQLSRKTMSKIKQNIFWALIYNVILIPAAAGLLYPIFGVVFRPEFAGLAMAMSSVSVVA
    NSLLLRNYVPPIRRGGDSVEKIVLELSGLSCHHCVARVKKALEEAGAKVEKVDLNEAVVAGNKEDVDKYIKAVEAAGYQA
    KLRS

    >gi|11498126|ref|NP_069351.1| NADH oxidase, putative [Archaeoglobus fulgidus DSM 4304]
    MRLDELKRSIRLRVFNSREIYDYLKKLFEDEEKITLEFNPNPEPRLSLPGVKIDNSEIYFHAIPKQNELESFIKAIKIVA
    EGVKGGSGIRIITFVAPV
    CPNCRATVDSINTLARKYAIEHHVVDATMFHDFAERHGVMSVPTTFIGKMRFVGALTPSKAE
    KWIRDAMNRDYRDYIIEKLASGEIEDVKAIVVEEKLGELLGELMGHEEFIVRLGAMATAEALEGEKEVVEGVKKAVRKLL
    THEDARIREDAAMMLGMLGGEEDVKELENLISEGGRVADSAREAVEEIRRRDNG

    >gi|11498163|ref|NP_069389.1| thiamine biosynthesis protein (thiF) [Archaeoglobus fulgidus DSM 4304]
    MLNKEQVKRYGRQILIPEIGGRGQEKLLKAKVLVVGAGGLGSPAIEFLAAAGVGRIGIADGDEVDITNLHRQTIHAGNLG
    VNKAESAASFVEKLNPDVEVDVYPFHLSAENAREVISKYDVVLDCTDSFSSRFLINDACVLESKPFVHAAVLRFEGQIMT
    VIPHETACYRCFLPEAPPPGSVPS
    CREAGIIGTTTAFFGVLQANEAIKLILGTGELFTNRLLYADILHNDFNFIEVKKQE
    KCRVCGESGIEELRSDYYVETCRIEAD

    >gi|11498271|ref|NP_069497.1| heterodisulfide reductase, subunit A (hdrA-1) [Archaeoglobus fulgidus DSM 4304]
    MAGEILVIGGGISGLTAAIEAAETGYDVILLEKNPYLGGRVSQLNKYFPKLCPPFCGLEILFKRMKSTPKLKYFTNAEVQ
    EISGESGNFTVKVKLKPRYVNENCTACGACKEVCPIEAPDEYNFGLKKKKAIDLPNIMAMPFQYYIDDKYCNKCGECVSA
    CKYNAIDLNEEEREMTLNVSSIIVATGWKPYDATKLDNLGYGKYKNVITNMEMERLASPNGPTGGVIQTMDGKPIETIAF
    VQCAGSRDENHLPYCSAICCLASLKQATYVREQYPDAKIYIFYIDIRAFGRYEDFFAKVKADEKIELIKGKVAKVEEVDG
    KLVVTAEDTLTGVKSKKEVDMVVLATGMQPAIEPIPGLELDEYGFVKPKPGIIPVGVAAMPMEVASANETATAAALKAIQ
    LARR

    >gi|11498296|ref|NP_069522.1| iron-sulfur cluster binding protein [Archaeoglobus fulgidus DSM 4304]
    MHHSHHLEIYEKLREKLNKAPIGLPKTVSGVEKELLSVLFDEEEAKIAVHMPFIRFTAEQLAERTGKSLEYVEKILNEMA
    KKGTVWKGEKDGQTYYRLFPVIVGFAETPFWPGPGKDPRQEKLARLWSQYRKEGFLDEIGDREHPIMRALPERDTISEKS
    EILPYEDAVKLVKERDYIAVGYCPCRVMARLVGEGCRHSIENCIHMGSVGKYMVEHGLGRRISADEAIEILRQSNREGLV
    HLTERSKHVATICNCCSD
    CCVFFKAVHEAKHPNTIAHSSYLATVDTSRCIACGICMLRCPMKAIKAKINREPASVDAEKC
    LGCGVCVPTCPMEAIELVERDELLELPDGMTYVQELLADKGRDPSGLF

    >gi|11498318|ref|NP_069545.1| thioredoxin (trx-1) [Archaeoglobus fulgidus DSM 4304]
    MPMVRKAAFYAIAVISGVLAAVVGNALYHNFNSDLGAQAKIYFFYSDSCPHCREVKPYVEEFAKTHNLTWCNVAEMDANC
    SKIAQEFGIKYVPTLVIMDEEAHVFVGSDEVRTAIEGMK

    >gi|11498375|ref|NP_069603.1| thioredoxin (trx-2) [Archaeoglobus fulgidus DSM 4304]
    MVFTSKYCPYCRAFEKVVERLMGELNGTVEFEVVDVDEKRELAEKYEVLMLPTLVLADGDEVLGGFMGFADYKTAREAIL
    EQISAFLKPDYKN

    >gi|11498837|ref|NP_070066.1| heterodisulfide reductase, subunit A/methylviologen reducing hydrogenase, subunit delta [Archaeoglobus fulgidus DSM 4304]
    MRIGVFVCHCGLNIARVVDVKELVEYAKTIDGVVHAEDIDYACSDSGQEEILNAIKEKNLDAFVVAACSPKLHEPTFRRV
    AIRAGLNPYMVEIANIREQCSWVHQAKPKAALAKAKDLIRMAVAKARTNRPLERRKAEIERSVAVIGGGVAGIEAALTLA
    DSGIKVYLIEKNPTIGGHMATLNEVFPTNDCSI
    CILAPKMSDVWNHENIEVITNAEIDEINGSVGNFRIKVIKHPRYVDE
    SKCKGCIDDCSSVCPVEIPNEFDYGIGVRKAIYIPIPQSTPLYAAIDWEHCIGCRLCEKACQPKAVDFSQQPETLEIKAG
    AIIVATGYKIFDARRKTEYGYGRFKNVITTIELERLLSASGPTMGRLLRPSDSTVPKRIAFIQCVGSRDEKTNKYCSRVC
    CMVSLKNAYAIKERYHDAEITIFYIDIRAFGRMYEEFYRRVQEAGVRFIRGKVGEIIENENGNLIVSYESTLEGEVREEE
    FDLVVLSIGIEGNRDVATKLGLGIGEDGFFEVAHPKLRPAETNVKGIFLAGCASGPRDIQDSVASAGLAAAKAAQLVLTG
    ETEFDPYNAYVDEEKCIGCRICEKVCEFNAVTVDRKAKINPNACAMCGICVAACPADAIDMGFFSDEGIKAMIDALGEEK
    NADPLALAFACWY
    CSYGAADLAGTTKVQYEPNVRIIRVLCSGRVDPEWVLRALARGIDGVIIAGCRLGECHFKYGNYKAK
    DRFEALKEALKEVGIEPERVRCIWHSAGEAEGIANDFNEFVEELKKLKS

    >gi|11498862|ref|NP_070091.1| iron-sulfur cluster binding protein [Archaeoglobus fulgidus DSM 4304]
    MHHSHHLEIYEKLREKLDKAPVGLPKTVSGVEKEILSVLFDEEEAKIAVHMPFIRFTAEQLAERTGKSLEYVEKILNEMA
    KKGTVWKGEKDGKTYYRLFPVIVGFAEMPFLAGPGRDARQEKLAPLWAKYRKEGFLDELGDREHAILRALPEKSTISKQS
    VILPYEDAEKLVRDRDYHAVGYCPCRIMARLIGEGCRHSLEVCLHFGSLGKYMVEHGYARRITADEAVEILRKSNREGLV
    HVTERSKGPISTICNCCSD
    CCAFFRAIHEAGHPKTIAHSSYVASVDSSKCIACGICMLRCPMKAVKAKINREPANVEAEK
    CLGCGVCVPTCPVEAIELVEREELQEWPDHLTYYQELLADRGKDPAGLF

    >gi|11498883|ref|NP_070112.1| thioredoxin (trx-3) [Archaeoglobus fulgidus DSM 4304]
    MDELELIRQKKLKEMMQKMSGEEKARKVLDSPVKLNSSNFDETLKNNENVVVDFWAEWCMPCKMIAPVIEELAKEYAGKV
    VFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAMPKSELKRWVQRNL

    >gi|11498950|ref|NP_070183.1| hypothetical protein AF1354 [Archaeoglobus fulgidus DSM 4304]
    MLMRDLAVGVVIGLIIGAIAVYAFTALQPSGEEVCPANPPESLDQKTLESVSKKLNNLIHQNNPDVSVRISDYSPYGEVY
    RVKVEFYNDNGTLESYDMFLTANGSLLFTNYVDLTKLSEEEVRINVSIDDDPFKGAEDAKVVIVEFSNYA
    CGHCADFAIE
    TEPKILEKYGDKVKIVFRDFPGFGEISYFAAEAANCAGEQGKYWEFHDLLFENQREWISNNSKIYDYAEQLGLNVDEFKA
    CIESGKYREEVDKDYKDGISYGVTGTPTFFIGTPNGTFVNGKKVAGALNFEQFAALIEQELQQAS

    >gi|11498973|ref|NP_070206.1| heterodisulfide reductase, subunit A (hdrA-2) [Archaeoglobus fulgidus DSM 4304]
    MKIGVYVCHCGENISSNVDIDELVEFAKSSEGVSVVRDHLFMCSEIAQEMIRDDIKSGKVDRVVIAACSPKNHEKFFRAT
    LEKAGISKYMLEIANIREQCSWVHEKNATEKAKSLLASSIAKARKLQPLEELCLDVNDSALVIGGGVAGITAAIELSKMG
    FKVYLVEKEPSIGGKMMKFDRIFPMNDCSS
    CVLYPLISEVSSSPLVELITYAEVEEVKGSVGNFQVKIRKKQTYVDWDKC
    IGCGACVEACPPRAVTEDEFNEGLTKRRAMYIASPYAIPRKAVHDPKSCVNCGKKTLGTRRFLRGGKEYLAPCEKACPTG
    AINRSLEWNPEGEIVEVNVGAIVVAVGYEVMKKQNFKEYLPPSPNVITALQFERILSPTGPTAGKVLRPSDMKKPETVSF
    ISCVGSRDVRYHTYCSKVCCMYMLKQARLIKERNPEIDVYIHMIDVRAPGKDLEEYYTQSRQMGIKIIRGKVGGIEELPD
    GRLRVLGFDADIGTPVEVEADLVVLATAIELSEDARKLAKNLGISVDTSGFLKEDHPKLRSVESWLDGIFIAGCCQGPKD
    ISETVSQAKAAAAGAAAILGRDFIQLEPFLATVDEKLCTGCGICASACPYEAISVNGRAEVDTRRCKGCGICSSVCPANA
    VDLAGFTREQILSQLEAIL

    >gi|11499131|ref|NP_070365.1| glutaredoxin (grx-1) [Archaeoglobus fulgidus DSM 4304]
    MAEVLMYGLSTCPHCKRTLEFLKREGVDFEVIWIDKLEGEERKKVIEKVHSISGSYSVPVVVKGDKHVLGYNEEKLKELI
    RG

    >gi|11499149|ref|NP_070383.1| thioredoxin reductase (trxB) [Archaeoglobus fulgidus DSM 4304]
    MYDVAIIGGGPAGLTAALYSARYGLKTVFFETVDPVSQLSLAAKIENYPGFEGSGMELLEKMKEQAVKAGAEWKLEKVER
    VERNGETFTVIAEGGEYEAKAIIVATGGKHKEAGIEGESAFIGRGVSY
    CATCDGNFFRGKKVIVYGSGKEAIEDAIYLHD
    IGCEVTIVSRTPSFRAEKALVEEVEKRGIPVHYSTTIRKIIGSGKVEKVVAYNREKKEEFEIEADGIFVAIGMRPATDVV
    AELGVERDSMGYIKVDKEQRTNVEGVFAAGDCCDNPLKQVVTACGDGAVAAYSAYKYLTS

    >gi|11499234|ref|NP_070472.1| tungsten formylmethanofuran dehydrogenase, subunit F (fwdF) [Archaeoglobus fulgidus DSM 4304]
    MEVERDLEMLEDGKFRYFQKAEDELRELYYDYKWCNGCGICVYACPVNAIELGPVHDIAIGLDMPPVIIDHLKCAYCGIC
    YSFCPFNALDFYINGERVDKSSLTLSPVMYTYKYETCRECTLCYKVCPTNAIKREVKITRQQIEEKNEGIEGKVEIDRDK
    CNLCGI
    CAEFCEVFKMVEKEPHPEDVMPYSDILIDETACDYCKLCEEVCPEEAIKVEGKRISFQLPEKIAEITIDQELCS
    HCSYCEEVCPYDAAKTIKPMEGKLELFEARMARCDPVGCAACIIICKHNRVWYVSKDKGRVHFNEKFCIYCGACENACPY
    DLIKVTRKSYFTKEVATDAPWREAWEEAVERIVEKSRVEEPFKFFIEEEELEVEEEELVVQPVDELRLKALQERIGVLEN
    VLKKARYRRALESGDSEVFVRGVKRALGEDKGEEKQKA

    >gi|11499265|ref|NP_070503.1| hypothetical protein AF1675 [Archaeoglobus fulgidus DSM 4304]
    MKAIYALLAVVALALVAVSLFSQSDSMEGWYSYQEGKKLSEEQKKEMFVFIGTSECGVCKRFKEFFRSNQSAMEFIRKNY
    IPVYVDAMREKTPVRVTFVPVFCTGFDGNLSCFSTAFPEELMMLLEK

    >gi|11499326|ref|NP_070565.1| hypothetical protein AF1737 [Archaeoglobus fulgidus DSM 4304]
    MVNRLINSRSPYLRKAANQPVEWFEWGEEAFAKAKKEDKPILLSIGGVWCHWCHVMAKESFENEEIAEMINRNFVAIKVD
    RDERPDIDKRYQEFVMATTGSGGWPLTVFLTPDGKPFFGGTYFPPEDRYHLPGFKTVLRKIAEMWRHDRERLLKSAEELT
    EAVRRYAEGSFKGDVDEKLLDKGIEAVLDQTDYVNGGFGSAPKFHHAKAVELLLTHHFFTGDEEVLKAAEITLDAMARGG
    IYDHLLGGFFRYSTDAKWVTPHYEKMLYDNAELLYLYSIAYALTGKRLYQKIADGIVEYYRKFGCSNEGGFYASQDADIG
    ELDEGGYYLFSDRELKEILDEREFRIATLYYDIQGERKLPRIFLTEEEISKILGVSVEEVERAVNSARRKMLEFREQREM
    PYIDTTIYAGWNGLMIEALCMHHKVFGDNWSLEMAEKTANRLLKEFWDGRELLHTHNVEGLSEDYIFFARGLLALFEVTQ
    RHEYLEKCFEIVDSAVEKFWDGEDGGFFDSERAVLGIRLKNFHDSPTQSVNGSAPQLLLALSAITGERRYEELAVEGLRT
    FAGLARRFPFSSASYLLSLYTFIKGVYVVKTEEHFESALKLFRPFKLVIKEYVDGIMVCEGNTCRFLDSTEDIINQGRLE
    EP

    >gi|11499442|ref|NP_070683.1| NADH oxidase (noxA-5) [Archaeoglobus fulgidus DSM 4304]
    MCIMKYDVLIIGGGPAGIVTATTAKKFYPAKSVAIIKKEETSLVPCGIPYIFKTLGSVEADVMPTKPAENLGIEFIIDEV
    EDVDVKAKVVRTKGGKSISYEKLVFATGSTPVMPRIEGVEKKGVFTVSKNIEELRKLHEAVKKAEKVVIVGGGFIGVEVG
    EQIAKAGKKFTMVEMMDQLLPAAFDKEFARIAEEELKKLGVEVYLNSTVKRITGNSSVEAVELADGRKIEADVVIMSVGY
    RPNIELAKKAGLRISIGNRIWTDEYGRTSEKDVFAVGDCSEEKDFFTRETSRVMLASTATFEARIVGANLYSLKVVRVNK
    GTVGVFSTFVGDVALGAAGLTEEMAKKEGFEVVAGYGESLNRHLASIPGAAKTKVKLIFAKESGVILGGQVTGRYEVGEM
    VNQIAMAIQNNLTASEIDTLQIGTHPLLTSAPTTPPVILAAEDALRKM

    >gi|11499727|ref|NP_070969.1| thioredoxin (trx-4) [Archaeoglobus fulgidus DSM 4304]
    MERLNSERFREVIQSDKLVVVDFYADWCMPCRYISPILEKLSKEYNGEVEFYKLNVDENQDVAFEYGIASIPTVLFFRNG
    KVVGGFIGAMPESAVRAEIEKALGA

    >gi|11499728|ref|NP_070970.1| glutaredoxin (grx-2) [Archaeoglobus fulgidus DSM 4304]
    MVMMKLFTSPTCPYCPKAEKVVSKVAKEEGVLAINLPVNTDEGLKEALKFGIRGVPALVINDKYLILGVPDEGELRQLIR
    KLKGGEEYGAS

    >gi|11499802|ref|NP_071045.1| hypothetical protein AF2220 [Archaeoglobus fulgidus DSM 4304]
    MKKYDAIVIGTGSAMIIVQGLLSMNPDSRIAVIDKYRPRGICLTRGCIPSKMVISVAEIIADIEKTRELGVDAEIKSVDF
    GRIMKRMS

    >gi|11499829|ref|NP_071073.1| hypothetical protein AF2248 [Archaeoglobus fulgidus DSM 4304]
    MKIKVVGPGCARCKATFDVVKKVVEKEGLDVELEYVTDMNEAIELGVVATPAVWVDGKVVIQGKIPKESEILEIIKK

    >gi|11499895|ref|NP_071139.1| methylated-DNA-protein-cysteine methyltransferase (ogt) [Archaeoglobus fulgidus DSM 4304]
    MFSVKWGELYFNVVMEGGKAVKSYFSTYPSFSSSDSEYARQLERYFSGERVEVRIPYRLKASSFTRRVLEEVSRIPYGMV
    RMYSDIAKALNTSPRAVGQAVKRNPLPVIIP
    CHRVVGKKEIGGYTVSCSDIDGKSLKKRLLRLEGVF

    >gi|11499984|ref|NP_071230.1| hypothetical protein AF2408 [Archaeoglobus fulgidus DSM 4304]
    MPSHTMDIERMLEERFRGREVPEAYKILSRRPETLLRFIEFRDSIMAEGKLNPILKEKIALAVSKVNYCNPCLISHSRKL
    EMMGESIEPLNEREKAALSFAAKIAITKGKLEDEEIQKILEIFDYDELLEIALVASLYMFLNTFNNLLVR

    >gi|11497960|ref|NP_069184.1| hypothetical protein AF0348 [Archaeoglobus fulgidus DSM 4304]
    MVEGSQEAKVAEILQKMEEMIGEEPKPQKLFSKVAPEWLERQMDERQFVMSLESIPEKYKHLIMIAVAAAVGSKMCTEVF
    TKIAKRRGVSEREIGEAILVARFALASTIFATVTPALEWLEGGDEE