Methanopyrus kandleri AV19 uid57883

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|20093448|ref|NP_613295.1| hypothetical protein MK0008 [Methanopyrus kandleri AV19]
    MGTPEGIDVITVVISEAPYGQERAYTALRFALTALVEGEEVKIFLIEDGVFLGKKGQNPDEVPNYLELLEQCIEQGAEVK
    A
    CGPCSKARGLSEEDFIEGVELATMHDLVNWVKESDNVIFF

    >gi|20093570|ref|NP_613417.1| methylated DNA-protein cysteine methyltransferase [Methanopyrus kandleri AV19]
    MLEVTLPGEGTPPAEGFRTLHSLKRDLERYFRGYPVDFDDVPVRINVSGKPREVLELVREIPYGTVVTYGDIAQKANTHP
    RVVGVSLARNRVPIIVA
    CHRVVAADGLGGFRWGLEWKRRLLELEGALPSRR

    >gi|20093689|ref|NP_613536.1| heterodisulfide reductase, subunit A [Methanopyrus kandleri AV19]
    MGDKDDVRIGVFVCHCGVNIKASVDVEEVVEYAKKLPGVVYATDYPFFCADPGQEIIQEAIKEHDLDRVVVAACTPKIHE
    NTFRNCVKEAGLSPYYMEMVNIREHCSFVHMQEPEKATEKAKDLIRAAVERAKRLEDVPTKEVEVENSVLIIGGGIAGIQ
    AALDLADQGFKVYLVEKEPTIGGNMARLAKTFPTDDCAM
    CILAPKMVQVGNHPNIEMITYAEVKDVDGYIGNFEVTIEKK
    PRYVDEDACTGCGVCAEVCPIEVPNEFDLGIGTRKAIYVPFPQAMPLVYTIDMEHCIQCGLCEEACPQDPPAIDFDQEPE
    EIRLKVGTIIVATGYEEFDASKLEEYGYGKYDNVITTLELERMINPAGPTEGHVIRPSDGKEPHRIVFIHCVGSRCPGKE
    EKGEAYCSRICCMFILKNAQLIKQHEPDAEVYCCYMDVRAFGKGYEEYYERAQKQFGVRFIRGRPAEIVEDPETKNLIVR
    VEDTLTGEPMEIEADLVVLGCGLVAPEETYSKLADILGIDRSPDGFFKELHPKLEPVSTKVRGVQIAGVAQGPKDIPDTV
    AQAKGAASEASIPMSQGKVEIELITATVDEDVCGGCGACAQVCPFDAIEMVEKDGKRVAEVQDVACQGCGQCAAACPSGA
    MQLRYYRDEQLMPQIEALLAEALEEEEEE

    >gi|20093705|ref|NP_613552.1| heterodisulfide reductase, subunit A, polyferredoxin [Methanopyrus kandleri AV19]
    MAEEEPRIGVYVCHCGVNIAGVVDVKEVAEFAKTLKNVVVARDYKYVCSDPGQEIIQRDIEKYDLNRVVVAACSPRLHEP
    TFRRCVEEAGLNPYCFEMANIREHCSWVHMDDPARATEKAKDLVRMAVAKARLLESLETIKVDVTDRALVIGGGVSGIQA
    ALDLADMGFEVILVEKEPSIGGRMAQLDKTFPTNDCSI
    CILAPKMVDVSKHPNIKMYTYAEVVEVDGYVGNFTVKIEKKP
    RYVDEDACTGCGACAEVCPIEVPNEFDEGLGMRKAIYKPFPQAVPSVFTIDEEHCIRCGLCEEVCDADAIDFDQEPEIVE
    EEVGAIICAIGYDTCDPTEREEYGYGVYDNVITSIELERLINASGPTGGKVVRPSDGKKPKRIAFIQCVGSRDPHRTNPY
    CSNVCCMYAMKLAQLIREKYPETQIDIYYMDVRAFGKGYEEYYERSQKQYGIRFIRGRPAEIVEDPETKNLIVRAEDTLL
    GDVVEREYDLVVLSVGMVPRDSADVIQEVLSISRSPDGFFMEAHPKLRPVDTAIDGIFLAGACQGPKDIPSSVAQGSAAA
    ARAATALAAGEVAVEPIVSEVDEEICGGCGTCVELCPYGAIELVEKDGKLVAEVTAALCKGCGTCAAACPSGAMEQNHFK
    TEQLYKQIEGAFRDPA

    >gi|20093795|ref|NP_613642.1| peroxiredoxin [Methanopyrus kandleri AV19]
    MKPDRRLDVRGAACPGPSVMVAEELKEMEPGQVLEVIVDSEGIANDIRELVQDGGHEVLKVEETDGDIRMLIRVGGVETD
    STATDGTVRTCAGSLPSTDTDSVMIAQSTGVANPERAYATFLMSEAALAMDLDVVIFGFMDGVTVLVEREVERIRHPEFP
    PLIDKAREVLRNVEA
    CACELSIQARGITSDDLLDGVKVVGASKFLKLITDPGVDVVWL

    >gi|20093900|ref|NP_613747.1| ferredoxin [Methanopyrus kandleri AV19]
    MLQDFLNHILSREGSKRLLDAHTSREIMQRPPRFRDFPDVDLDRCILCGACADACPVEGRDGCPPAMEMSEEGPVLHKER
    CIRCGLCVEVCPTGAIEMGTLHEEVEERVQPPKPARIVVDSDLCVGCGKCESACPSDAITVEETAEVDEERCVLCEVCLE
    VCPVAGAIKLVPTDTDELVKRWKEYLEASLRG

    >gi|20094285|ref|NP_614132.1| dihydrolipoamide dehydrogenase [Methanopyrus kandleri AV19]
    MDVVIGAGPAGRTYAMILAEAGHEVLLLDRNGKEGTGGKCLNEACVVLGALIEAARLVVWAKLGIPGVELDVGDINFRRL
    TRSVRKVVETIRQRLIKETERAGVEILRAEAVKVDESLNVYTKDGDVLEADRVLIATGSRPAIPEVEGVDSDAVFTFREI
    LEMEVPSELCVVGGGPTALESAFAFAALGSEVVLAYRSRILPNAPEEVRREILKDLELVGVNAVRAGELRAIRETSSGVE
    CRFERGATVADAVLLATGLEPNSDIAANSGLPLRKDGSVVVDDGMRTPRDGVYAAGDVTGPPYLTPVARYEGTVAALNAL
    GKNVRRGNPPAPRVIRLFRDFGRLELRGIDWEGSLPTPVGGPAFWMLHHGIKGKMVCRKRGVTTEAFIVAPRIAPMLPYP
    RCVEPDWRLIEVHPTPDPVIGLLKQLGLRRTLGE

    >gi|20094317|ref|NP_614164.1| NAD(FAD)-dependent dehydrogenase [Methanopyrus kandleri AV19]
    MRVVVVGGGAAGVVAARTAREHGADVVLISADEHIAYSPCAIPFVISGEIERPEDILMRDPTHYERLGIDVRLGVRVEEV
    DPEEKVVTTEDGDTVEYDSMVLATGGEPLVPPIEGSELDGVFTVRRFSDIEPLLRAVQESERAVIVGAGPIGVEMAYALH
    ERGLEVTLVEMLDRVLPQFLDDDVAAIVQERMEKEGVRVLLGSPVEAIEGDDRVEAVVVNGEEIEADLVVMAAGVRPVTD
    LFESIGASVLPFGVEVDPALRVKREDGGVFDDIYAAGDCVADWCPITGERVPSQLGTVAVRQGKIAGKNAAGGPRATWMG
    TLNTAVIRVFDLEAAGAGLTQTRAEELGLEVVSATVETTTRARYYPGGEPIAVKLIADADTHRIVGVQSVGGERVRERVD
    GVALAIRLAAKVEDLLSWDYSYSPPVARVIEPIYEAAELLREELHS

    >gi|20094805|ref|NP_614652.1| selenophosphate synthetase [Methanopyrus kandleri AV19]
    MSRKKSLVEMADLHGCACKLPQGDLEDLLKGVELPEEGGRVEVGVGDDAAVIRVDGGYVIQSVDFFTPIHPDPYTQGRIA
    ANNSINDVFAMGATEVLSVLVVSGFPRELPEEDAREMLQGFADQCREVDALIVGGHTIMNPWPILGGCVTGFAERYVTVG
    GAEPGDVLYLTKPLGTQPAMAALRLPEDVRKQFLTDSELEEAVDLAVEVMTEPLKDAAEAALEVGVHAMTDVTGFGLKGH
    AGEMAEASGVRVVIERLPVIPGTTELSRALGYGLERGESAETAGGLLVAVPEEHAEDLEDAFERRDVWYRRIGRVEEGSG
    VEVRGDVEEVEDYP

    >gi|20094993|ref|NP_614840.1| OsmC family protein [Methanopyrus kandleri AV19]
    MADVIAEFLGDGECTVEFEEEKMELVSGKVAEPGHVTPYHLFLAGILACVTMNAGHALEKAGIDAEVTAEVTGEKDWDRL
    AVTEIEITIKVKLKDDTDPDEARKIAEKGADR
    CILSRTLGPAIVSKEVVVERES

    >gi|20094997|ref|NP_614844.1| thioredoxin reductase [Methanopyrus kandleri AV19]
    MAKPYDVIVIGAGPAGLSAAIHAARAGAEVPVVAQELGGQLTTAPEVGNYPGFPPAPGYELVDRMVEHAETVGVELNVKY
    SNRVEGIELTDGTFRVLDEECRAVVIATGARPKRLGVPGERELEGRGVSY
    CAICDGPAFQNRIVAIVGSGTHAANTALFL
    SEIAERVYVITPDGKLESPDRALIERVLSCRNVEVVHDEVRRIVGDERVEGVELSDGDILPCEGVFIAAGKVPNSEPFRD
    LVETDDRGYIVVDSEMRTSLEGVYSAGDVTTIPHRNVPSAVYQGSVAGINAAEYALKSR