Methanoplanus petrolearius DSM 11571 uid52695

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|307352364|ref|YP_003893415.1| peptide methionine sulfoxide reductase [Methanoplanus petrolearius DSM 11571]
    MSEETVVFAGGCFWHVEEAFGKVRGVIRTRVGYTGGKLDNPCYEDVCTGNTGHAEAVEVTFAPEAVSYRDLLKEFFNMHD
    PTTLNKQGPDVGTQYRSAIFCRDELQKNEAENFVRELEDESRFGGKEIVTEVVPLGKFWEAEEYHQKYLFKIRNQGVNPE
    CRVDLGKRE

    >gi|307352451|ref|YP_003893502.1| heavy metal translocating P-type ATPase [Methanoplanus petrolearius DSM 11571]
    MSEKPVKKTSLKVTGMHCAACAANVESALKKLEGVDSASVSIASEDAQVSFDPEKISLGDIESTIKKSGYGVSLAEQKIK
    IGGMH
    CAVCAGSVKTALEKVNGVMSADVNLVDNSAVISYIPGDTDKREFKTAVESAGFQYMGTEEDFSSEKEEEEFEKEQ
    KNKLVRIVLGLGTAAVLIAIMYSGLSAFIPVNLLMFIISTPVLIYLAYPIFSATFISLRNRTLSMDVMYALGIGTAYIAS
    VFGTFGIVLTSDFMFYETAVMLTAFLTLGRYLEANAKGRTNDAVKKLLNLKPAKALVKKDGEYVEIPAEDLMEGAEILVK
    PGGRVPVDGTVLSGEAYVDESMITGEPVPVLKKQGDTVTGGTLLTGGSVAFTATKVGKDTVLSQIISLVEETQRTKPPVQ
    RIADVAVAWFIPVILLIAIVASSIWYFLLGSTTLFALTVFISIIVVACPCALGLATPTAVTVGIGRGAELGILIRNGEAL
    EISEKLKTIVFDKTGTLTRGKPEVTDITSFGMEEKEMIGLAAAAENFSEHPIAKAILDYAKDKEIAVPEGENFRSEAGGG
    VEVTAGGKAVTAGTRDFVSNSGAVIDEKTEETLAAYESAGKTTVTVAADGKIVGVLAISDVLKDSAGKAVSEIKAMDLSV
    SMITGDNAITALSVAKEAGIDDVHANVLPGEKAAQVKKIREESGMTAFVGDGINDAPALAEADVGIAVGSGTDIALESAD
    IVLMKSDLRDVAAAIQLSRKVMGRIKLNLFWAFAYNTALIPVAAGVLYPFYGIIFRPEYAGAAMVLSSVTVISLSLMLKG
    YRPPAVAER

    >gi|307352513|ref|YP_003893564.1| redox-active disulfide protein 2 [Methanoplanus petrolearius DSM 11571]
    MKIEVLGTGCMKCKRQMKNVEKAVAESGIPADIQKIKDIEEIINRGVMLTPAVAVNGEIKVSGRVADVAELKKILDEAQ

    >gi|307352595|ref|YP_003893646.1| DsrE family protein [Methanoplanus petrolearius DSM 11571]
    MVKTIPARGIKSPNASILAANVIRHSAEPDEEIRFLLSPGAEKGMDAVAEKFGYNLETGKNGGDVEVRMTPHGTKMQEVD
    VTGDTCPGPAITVGNILESLGIGERLKVKCANGSTLEDIARAVTSGGSRVIEEGGEGDRHYLIAEKAERPAAGEASALAA
    NLDSVVIIQSNGISNAERAYATFLFSKVALSMGKTVTIFLLMDGASMAKKGAATGVKHPSFDRLDSLMNEVIEGGTKVYV
    CELSAQFRGINEGNLVEGMKIAGAATYIDLISNPANAVVNF

    >gi|307352681|ref|YP_003893732.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanoplanus petrolearius DSM 11571]
    MGPEKIAVIGAGPAGMAAAIQLSRYGIRPVVFEKDKTGGLLPNARLVENYPGFPDGIRGTELSALFRKQFEKGSPELKTE
    TVLQLDLDGKEFLIRTETETYRFDRVIIASGTVPKRPGCNIDTDALA
    CTYHDISRIRDLSGKTVAIAGSGDAAFDYALSL
    CTKNRILILNRGEKTKCLDILFKEVAGSPNITYIENTNISGIVKTQNGIKLQCVSGGSNIEIDADIMIFATGRDPCTEFI
    SSEISGRTSELTGSGLLFFTGDVRNGILRQTAISVGDGVAAAMRICKGPGGDAD

    >gi|307353043|ref|YP_003894094.1| type 11 methyltransferase [Methanoplanus petrolearius DSM 11571]
    MNKMTDYKEKIADYWNWRSTTYHEEFSDLIKEEMEVWKKTLSEYIPEGKTIRAAEIGTGPGVLALALADLGHSATGVDLS
    EEMIKKAANRAEELGIDAKFMQGDAENLSLDDGAYDLVISKYLMWTLPHPEKFLEECRRILSPGGTLVLIDGVWFNEADK
    EPEPDSETYFEE
    CYQDIKEALPLCKGNTADKVTEIAAELGFSDASWQSLSDYDKFLREHSSPEDYAASYLAPPYIIYARK
    PC

    >gi|307353080|ref|YP_003894131.1| FAD dependent oxidoreductase [Methanoplanus petrolearius DSM 11571]
    MSEIAVIGAGAAGIQAALDAANRGIKVHLIEREPTIGGRMAQLDKTFPTNDCSMCILSPKMVEAERNENIILHTLTEPVS
    LEGEVGNFKLTLLRHPRYVDAELCNGCGDCYEVCPVEVYNRYDAGLGVRKAIYKPHAQIVPNLAIRDPEHCIDCGLCYDV
    CGREAVRHDDEDSEEEFTINVAAIIIATGYDTYNPEKKTELMYLRHPDVITSLEFERMICASGPTGGKLRKLSNGEKPRS
    IVFVQCIGSRDLTIDRCYCSCVCCMYAIKNAMLIKEKNPDTGVTMLYMDIRAYGKGYEEYYERAKNLGINFVRGRPGEIL
    EKPGKGLEIMVEDTETREFLKLSPDLIVLSVGMQPSKGADRIAEIFGIKTEDSGFFSSPEMKLNPVGTIRPGIYIAGAAS
    APKDIPDSVTQGEAAAMKAFLDALKAGA

    >gi|307353374|ref|YP_003894425.1| FAD dependent oxidoreductase [Methanoplanus petrolearius DSM 11571]
    MRKVAVIGAGITGIQAALDLSKHGIEVHLIEKEPYIGGHVAQLGRIFPTGDWSACILASKINEVLRAPGITLHTMTEVTG
    LEGEPGNFTLHLRKHPRFVDIDKCTGCCTCSDVCPVELYNEFDAGLGVRKAIYKPYNEAAPIAAIRDSDHCINCNLCFDA
    CPNDAVLRNDEDGIADLSIQGICSVVVSTGYRMYDPRNEPRYRYLTMPDVITSLEFERMISPGGPTGGEVRRLSNGKIPK
    SIVFVQCVGSRNIAVGRNFCSAVCCMYTIKNAGLVKEKYGDSINVTILKAETRAYGKDYQEYNHRIKKTYEIKVLRCTPG
    SIEYGEGNRMRIVAEKVKKGFPETPIVVLEPELVVLAVGMAPSKDVESISRIMGLDRSSVDGFFCPNEQVLDPTGTPRPG
    IYIAGTAIAPKDINDCVNQAEAVSMKAFVDAYSD

    >gi|307353397|ref|YP_003894448.1| glutaredoxin [Methanoplanus petrolearius DSM 11571]
    MSDNPKINVYSLEVCPNCELLKRFLKSNGFEYTELDLSLPENMTELRLNNVFVREAPVLQVDETFMTSGDLFKSGAVDEE
    KILPLCKGE

    >gi|307353488|ref|YP_003894539.1| glutaredoxin [Methanoplanus petrolearius DSM 11571]
    MTEWTVVEGRDKGSIVLYALSTCIHCKKTKELLNELGVAYKYIFVDLLPEDELNIFYDEMKKYNPAGSFPTMVINGDKVI
    VGSRLEEIREALNGD

    >gi|307353643|ref|YP_003894694.1| thioredoxin domain-containing protein [Methanoplanus petrolearius DSM 11571]
    MSSPVTMELNDLNWENFVEKTEKPVIVMFYSEKCPHCRTIMPYFEEYAGKYHEKMRFGLLNISDAIWLSEKFGVMATPTF
    KFFCGGRPVQEMVGAVYPNIIEKRIAEMIEHGAECVEKSTEIKYEITGYG

    >gi|307353835|ref|YP_003894886.1| thioredoxin domain-containing protein [Methanoplanus petrolearius DSM 11571]
    MSKPVLIDFYADWCGPCKMQSPILDQLKDKMGDSIEIKKVDVDENMDLAMKYGIQVVPTLVIEKSGKIEHRLEGVTPAET
    LESLLKPLL

    >gi|307354050|ref|YP_003895101.1| alkylhydroperoxidase like protein [Methanoplanus petrolearius DSM 11571]
    MKEVDFENALKKISETGKEKSAKELLQRVERETGEIPLIYEKMAKKPEVLISHLLYKCAVTETSTLEPKTVELICLAVGA
    ALNCPH
    CTEYHMRAAKAKGATKDEILEAVLLAGSLAQASVLADAYRVIETDEEGCKGSCELNGFTLRD

    >gi|307354060|ref|YP_003895111.1| methylated-DNA/protein-cysteinemethyltransferase [Methanoplanus petrolearius DSM 11571]
    MVMRKGACRFGYWWVQVEWSGDTIHRIQFSRKGDESYIPPQIRQFVKGKSTQIAGLKSIALSDGHPYREIYESVKEIPYG
    EVKTYSEIGTETGFHARTIGVAMRRNPTPLIIP
    CHRVVAKNGIGGFTPEIDIKKALLDMEKKNSTTPITKKNKNKMEES

    >gi|307354106|ref|YP_003895157.1| alkylhydroperoxidase like protein [Methanoplanus petrolearius DSM 11571]
    MEKFVRDKINQGIVDRRELHSRFLENCSTYGSFTELEKKAFEDGALSRKHKELMALSISIVTKCEPCIEWHVQQAHLAGA
    SEKEIFETIDVAIEMGGGPAAAYSRFALNALDFHKEGK

    >gi|307354115|ref|YP_003895166.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Methanoplanus petrolearius DSM 11571]
    MDLIAVGETAPPFCLPDSWHSEVCIEAFRGRWVILYFYPKDNTTGCTLEAQTFSAEMSDFRGMNTIVIGISPDSCESHEK
    FMKKHSLDLILLSDETHVVLEKYGVWQKKKLYGREYFGVDRTTYLINPEGVIVEVWPKVKVKGHAEEVKAKVVSLAGNNP
    E

    >gi|307354170|ref|YP_003895221.1| DsrE family protein [Methanoplanus petrolearius DSM 11571]
    MSVNQRITVVIGDAPYGNERPFSALRFTVAALIEEMEVNIFLIENGVYLGIKDQAPSDYPSHENLLVEAYENGANIKACG
    PCCKARGLTQECLLEGIQMATIHDLVDFVVQSEKTIFF

    >gi|307354172|ref|YP_003895223.1| selenide, water dikinase [Methanoplanus petrolearius DSM 11571]
    MSDIEKRKLTSIAPLFGCSCKLPETELETLLEDINISYSPEILCPGDDAAVIKINDDLAIIKTTDFFTPIVDDPYIQGKI
    AACNATNDVYAMGATEIVGVLALLGIPRELPLENARMMLKGFQDFCNSIGTSIVGGHTIINPWPFIGGAVTAISSPDKIV
    YHSGAQPGDVLLLTKPLGIQPAMASTRLSSEYSSIIQSTLDSDIVANAVNLAIECMTTSNLNAAKAINEVGANALTDVTG
    FGLYGHGLNIARKSNVSLNIDLIPIISGTLELSALFEHGLEEGKSAETAGGLLMSVSEENLDEIIHSLNKYNVPAYEIGT
    VKEKGNEHVVIDNPEILEISSLSVKFES

    >gi|307354183|ref|YP_003895234.1| Rhodanese domain-containing protein [Methanoplanus petrolearius DSM 11571]
    MLLKHFYVEKIAHSSYLIGGNKTCAIVDPARDVGKYIHAAKEEELDITHILETHLHADFISGHIDLAEKTGAAIYAPKNG
    NCEFEHVAVGEGSTFSIENIEFHVLDTPGHTPDCLVYLVNDLSRGDETVLAFTGDTLFVGDVGRPDLFPGRAEELAGKLY
    DNINNKIAKITGDCIVLPAHGAGSLCGKAIGTMKLSTIGYELKYNREILIKDKNDFIRSLTVGMPPAPDHFGRCSEINRK
    GPVPVESLPEIVPMTPAEFREKMNDGKTVVLNTCDYAAFGGHHIPGSWHIDMSGNLSTFAGWVLPPEKDVLLVTDNQQQA
    EEAVVMLRRVGLDHAVGYLDGGTHAWVAAGYETGHVPQLSANEVHEKLNGGGYTLLDVRTEDEYREKHVPGAVNILAMDL
    RTRYRELDTEGPLIAM
    CRTGRRSSLACSILKQHNFRNICNASGGITGYIAAGYLK

    >gi|307354184|ref|YP_003895235.1| hypothetical protein Mpet_2049 [Methanoplanus petrolearius DSM 11571]
    MEWTPYIAGIGIGILSWIAFLLSDKPLGCSTAFSNTSGMIERLFRGKKTEDKEYYQKYKLGIDWQWMLVIGIIIGVFITS
    VLTGGFAIEWVPDTFADKFGYNPVLRWIFAIVGGILMGLGARWAGG
    CTSGHGISGALQLAISSWIAVMMFFIAGIATAML
    IYGVL

    >gi|307354602|ref|YP_003895653.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanoplanus petrolearius DSM 11571]
    MSENQEPRIGVFICHCGTNIAGSIDIQAVKDYATTLPNVIVADEYQYMCSTPGQTKIIDAIKEHNLTGIVVAACSPRLHE
    PTFRVATAEGGLNKFRFEMANIREHNSWVHMHDWDLATSKAKDQVRIAVAKARLLEDLEPKEVPVEHAAMVVGAGVGGIQ
    AALDLANAGIKTYLVEQTPTIGGRMSQLDKTFPTLDCSQ
    CILTPKMVDAGRHPNIILRTYHEVENVEGYIGNFEITLRKK
    ARGTRNEAEMKADGITGSGCNGCGDCATVCPVIKPNPFEFGMAPRKAIYIYHAQVMPLQYTIDYDACVKCGLCVDACGVE
    KNAIDLNMVDTFEKIKVGCCILATGYDLIPIEDKKEWGYKRYENVITGLEFERLICASGPTGGHMIRPSDGATPMKVGFV
    LCAGSRDNTGGVGKPYCSRFCCMYSLKHAHQLMEKIPGCQPYLFYMDIRSFGKMYEEFYYRIQNEGAKFVRGRVAELLED
    PNTKNVIVKTEDTLLGRPVSIECDLVVLAAAIQPKPDAEPIRQMFGISKSQDGWYLEAHPKLNPCGTTTAGIFLAGVCQG
    PKDIPDTVAQAEGAASAASIPIHQGKVQLEPYFAQCMEDLCAGCGMCVPQCPYGALSLTEKNGRQVMQVTEAKCKGCGTC
    GGFCPGGAIKMQHFTTPQICAQIDAFLLGGLGGEE

    >gi|307354608|ref|YP_003895659.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanoplanus petrolearius DSM 11571]
    MSENQEPRIGVFICHCGTNIAGSIDIQAVKDYATTLPNVIVADEYQYMCSTPGQTKIIDAIKEHNLTGIVVAACSPRLHE
    PTFRVATAEGGLNKFRFEMANIREHNSWVHMHDWDLATSKAKDQVRIAVAKARLLEDLEPKEVPVEHAAMVVGAGVGGIQ
    AALDLANAGIKTYLVEQTPTIGGRMSQLDKTFPTLDCSQ
    CILTPKMVDAGRHPNIILRTYHEVENVEGYIGNFEITLRKK
    ARGTRNEAEMKADGITGSGCNGCGDCATVCPVIKPNPFEFGMAPRKAIYIYHAQVMPLQYTIDYDACVKCGLCVDACGVE
    KNAIDLNMVDTFEKIKVGCCILATGYDLIPIEDKKEWGYKRYENVITGLEFERLICASGPTGGHMIRPSDGATPMKVGFV
    LCAGSRDNTGGVGKPYCSRFCCMYSLKHAHQLMEKIPGCQPYLFYMDIRSFGKMYEEFYYRIQNEGAKFVRGRVAELLED
    PNTKNVIVKTEDTLLGRPVSIECDLVVLAAAIQPKPDAEPIRQMFGISKSQDGWYLEAHPKLNPCGTTTAGIFLAGVCQG
    PKDIPDTVAQAEGAASAASIPIHQGKVQLEPYFAQCMEDLCAGCGMCVPQCPYGALSLTEKNGRQVMQVTEAKCKGCGTC
    GGFCPGGAIKMQHFTTPQICAQIDAFLLGGLGGEE

    >gi|307354612|ref|YP_003895663.1| alkylhydroperoxidase like protein [Methanoplanus petrolearius DSM 11571]
    MDNDTEEVIQDFLSHSDQIGESLYAEFNEIFGLVPFIFTAISERQKPFVFNSLGDLYTSRPESLDPKTAEIATIAAAAAC
    GADK
    CLGVHIKAALRAGVTRDQILDTILIGAMINRTRSLAVSLKVFESSAGKAEDQKP

    >gi|307354729|ref|YP_003895780.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanoplanus petrolearius DSM 11571]
    MITVIGGGPAGRLASIHLALGGREVVLIDKRKELGGQCLHKGCMVICALNDIARSLEDCRNLKELGVFDTVPATDYSLAL
    KGMKKTQEKIAKVLDKETRDCGVDVVTGEVSVNGKEYTLDGEKTKPDSLIIATGSIPAIPRVEGIGLPGVYNPHTITEHG
    ILPEKLAIIGGGVVAAEYGYIFSSLGVETEIISRSSFLRGKPGHLVKAAKKELESVNIRENSALKRITGEENVTGADIIQ
    KGVKLHTEADMILIATGLSPNSGMISGIKKGSMGEITVNERMETDIPGVYAAGDVTGPPFLTPVARLEGIIAADNILGKK
    VRSIPACIPRSIKLRYEHSFFETDNENRTEISIPAPAGPGSFWYVHKSHTGRTMISTEAGKDNINGMYLGSPGSGPALAQ
    MAYNISKSAETPDFSEYLEIHPSTDGIPYLIKYMNQLKESRQ

    >gi|307354751|ref|YP_003895802.1| peroxiredoxin [Methanoplanus petrolearius DSM 11571]
    MCEDVEMDRGPRLPVLGEKAPDFQAVTTHGPLKLSDFEGSWVILFSHPADFTPVCTTEFMGFAEIYDELKSLNTQLIGLS
    IDSVHSHLAWVRNIKEKMGVEIPFPVIADLDMKVANLYGMVQPGQSSTSTVRTVFFIDPVGVLRAMLYYPLSNGRNMQEI
    LRMLRAFQASDEHGIATPANWQPGDKVIVPPPVNQKDMEKRLSEGYECKDFYLCFKKL

    >gi|307354759|ref|YP_003895810.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanoplanus petrolearius DSM 11571]
    MEKAVTMPDVKVYSTKQCQYCRLLKAFLDKKGIKYQNIDVGEDIEAAKEMVELSGQYAVPVTVIDGEVIVGYDVRRLNEL
    FGDTGEKGEIDIIILGGGPAGLTAAAYAARKLLRCMIITEDIGGQALESWAIENYMGFRIISGSDLMQKFEEQVRNEDIE
    IEIDRAESIEESNGKFVITTVSGQKFEGKSVIIATGVKPRWLGIKDEEKYIGHGISI
    CSTCDGPLFRDKIVTIVGGGNYA
    VTTAIEMSKLATHVNLIVRSKIRADEVYTSQYEGLENVSTYKNYTVSALEGDNMLKAVTIKERDTGEESKLETDGLFLAI
    GHDANTGFLEGFVDLNENGEIITDNNGRTSHNGVFAAGDVTDTKSKQVIIASGEGAKAALSAYSFLVNK

    >gi|307354791|ref|YP_003895842.1| thioredoxin [Methanoplanus petrolearius DSM 11571]
    MSGSDNADDDIQKLREQRKAEIMNEIGKKRNPGVTVVDELNFRAFISENRFSVLDVWAEWCGPCLRVAPVIEEFSNEFSG
    KIAFGKCNVDENQNIAASFAISAIPTLLFFSEGKLINRVTGAYPKEALEKQIRSTFPGI

    >gi|307354944|ref|YP_003895995.1| type 11 methyltransferase [Methanoplanus petrolearius DSM 11571]
    MTEKGIKNLVRENYGKVARQEKNSCGCSPCCCGATQSAEELSMKAGYSGDEISEVPEGANLGLGCGNPVAIASLKEGETV
    LDLGSGPGFDCFLAANRVGKSGRVIGVDMTPDMLKRARKNAEKGGYTNVEFRQGEIEDLPLEDCSVDVIISNCVINLSPD
    KQAVFNEAFRVLSPGGRINVSDIVVTERLPDFISESGTGYTG
    CIAGALLKDEYLGCIEKAGFRDIEIVSEAIFPLDQFTS
    DPVVQDILKDEGITKERLAEIEKTVLSVKVRAYKK