Methanohalophilus mahii DSM 5219 uid47313

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294494826|ref|YP_003541319.1| Rhodanese domain protein [Methanohalophilus mahii DSM 5219]
    MSKNTIVVLICVLGTLALGGCVQQEDDNTASQLENCEYSDVSAEEALNLIEEQDVFILDVRTRSEYDAGHLEDSYLIPVS
    ELKNRLDEVPRDTAILVY
    CRSGRRSVTASNILLDAGYCDVYNMEAGFNEWRSAGYPYMG

    >gi|294494830|ref|YP_003541323.1| Methyltransferase type 11 [Methanohalophilus mahii DSM 5219]
    MKIRESGMPDENVWEGFFGVDEILKKLGLNDKIAYVADFGCGYGTFTIPAAKIIKGKVYAIDIESEMIEIAEQKAKVENL
    GNIELLLRDFISKGSGLEGESVDYIILANILHVEEPEKLLRETYRVLRQEGKIVIIHWNYDPTTPRGPPMEIRPTPEK
    CI
    EWAISSGFKNPLTYDLKPYHYGIVLSKGKN

    >gi|294494843|ref|YP_003541336.1| periplasmic binding protein [Methanohalophilus mahii DSM 5219]
    MHKKFRYILLIFIILFAVYTSACVDQKEVSAQSTRSITDMAGRTVEIPADVDKAITTSPPATMLIYMLAPEKLAGWNFMP
    QESETYLKPEYRAVPVIGGWFGKQDGNYETIISMGPDIIFEGYTS
    CGDVNSTINERQKKFGTIPVVGIEATTDATAYEEP
    IRFMGEILGENERAGLLISFYKETLDTVTTKTSRIPEEEKKRVYYAEGPDGLLTDPKGSAHSQLIEVCGGINVAQCPIEQ
    GYGRSEVSIEQVLQWDPEVIITGDRNFYKNVYEDPLWQDITAVKNDEVYLFPDAPFCWFDRPPGVNRIIGIPWTAKVLYP
    QEFSDLDLRGNVKEFYSEFYHYELSEDEIDDLLDPASGAN

    >gi|294494844|ref|YP_003541337.1| Methyltransferase type 11 [Methanohalophilus mahii DSM 5219]
    MTEELTERVGFHDEYAENFEDVAANIFAPIYPVISQQIINRCQIKSGNFIDVGSGPASLAIALGEIVDGKVYAMDFSEKM
    LAIAKRKIESFDLNENVIPIFGDVHDMPFEDCFADLIVSRGSLFFWQNVPEAFREIYRVLKSGGMAYIGGGFGTAELKSK
    ITQAMEKRDPEWSK
    CVGKRLDRTNLESFKKALHVAGIDPYTIIDDESGFWICLKKVD

    >gi|294495002|ref|YP_003541495.1| glutaredoxin [Methanohalophilus mahii DSM 5219]
    MSEIIVYTTDVCPKCARLKATLKENNVQFEEADMTSAEALTELRINGVFTSEAPVLQIGDDFLTSDNIFKGSDVDMDVLQ
    DWIY

    >gi|294495064|ref|YP_003541557.1| UBA/THIF-type NAD/FAD binding protein [Methanohalophilus mahii DSM 5219]
    MLNDVDKELYSRQIMMIGEDGQDKLKGATVLVAGCGGLGSPVLNYLAVAGIGHIRLIDKDTVELSNLNRQILHWHRNIGK
    PKSLSAQEKLGELNPNIKLEAINAEINADNADELAQGVDIIVDALDNYDTRVLLNRMAINKGVPLVHGAVHGFHGQVTTI
    IPGKTP
    CIECLIPEKPPKEIFPIIGCTAGIVGTMQANEVIKYLLGREDLHSGHIVMWDGRSGTLDRMKICRRMDCPECGH
    L

    >gi|294495083|ref|YP_003541576.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanohalophilus mahii DSM 5219]
    MAREYDIVIIGTGVAGTVCANKASAAGMKIAITDIREYGGTCALRGCVPKKVLVGVAETVEQVNRFNKLGIMPQSSVNWN
    KLMDFKQTFVDNFPQNKEEKFTNMDIDTYHGGAKFVSKNEVKIADTILKGKHILIAPGSVPRKTGIKGEENLITSEQFLN
    LDELPRKIVFVGGGYISFELAHIAARAGSQVTILQRSEVLKQFDRDMVKLLVKASEEAGINVNTGISVSSVESTSSGFTV
    NTRNREGKESRIECDLVVNGSGRIAALEGMELEKGNVETKDGFVETNDYMQSVSNPYVYAAGDCVKPGAPLTPVASLQGT
    TAADNMIKGNVKTVDYTGIPSTVFTLPPLSSVGISLSESTDRYEVLIHDRSHWYNSRRLSENYAASKVIIEKESQKIAGA
    HILGSHSEEVINIFAMAIRLGLTLSQFKKVVYVFPTVSSEIQSMIRG

    >gi|294495098|ref|YP_003541591.1| CoB--CoM heterodisulfide reductase subunit A [Methanohalophilus mahii DSM 5219]
    MNDSKKPSGIFICHCGGNISDNIDIKKLKDSFPDCKVFDYEYLCSNRGQQYLKDEIENSGLERVVVGACTPAKHENLFKK
    CASQCGINQEFLRVVNLREQCSWVHTDSDRATHKAFSMLNSSMLRLFRAQPVEQYSLPINPDALVIGGGIAGINAALNLA
    NSGVHTYLVEKETTIGGNAAKIGKIFSPEKLVEECAM
    CSLSPLMNEVASHPKIELLTDCEIRNIDSITGNFQVSITQNPR
    YVTDKCVCCGKCAAVCPVVTENEFNCGSKDKKAVSIKFAQAVPQIYSINPEHCIELKGGRCGKCREVCNVDAIDFSQQDK
    HIEIQVGAIIAATGFGEYDPSSKPQYGYGRFPNVLTQMELARILGVNGPTQGKLLRPSDAKRPKNVVMIQCVGSRDEKSS
    GNRYCSRYCCMAALKHASLIKKKYPDVNVTICYIDMRAFGLYEHYYRAVQEMAVQFVRGRPAEIAERDNSELVVKVEDTL
    NQQLMELPADMVVLSAAMEPSEGTQQIARIMDTNLSEDGFIKERHSKLRPVDTSKEGIFVCGSAQSPKDITDSIAQAGLA
    ASRAHAFLAAGEIYLDPHIAVADPDVCTLCGKCVTCPFGAISIEDKVKIDPLVCNGCGYCTSLCDEDAIHIRGYSREELV
    AEIEGLAQAGDTIVFASCNIAYSTIDNIGSSAQDYPASTKIIRVPTTTIVTAEMLDMAFNRGVFHVVFVEEPPDNQIGEI
    IYPLAEARFFELKAEYGDRLHLKKAYIPHAKGLSDMFSSLEEVEE

    >gi|294495152|ref|YP_003541645.1| alkylhydroperoxidase like protein, AhpD family [Methanohalophilus mahii DSM 5219]
    MSEHEELEHEELLDSMSNKLGFTPQILKTLGEIDPHFLKKYNHCNQKLLSDGALPAKMKILMALAVVASKQCERCTVVQM
    QSALKNGATAEEIMETMEVISITSGAPAVAACRDALKLLKE

    >gi|294495233|ref|YP_003541726.1| 3-Cys thioredoxin peroxidase [Methanohalophilus mahii DSM 5219]
    MEEAEPTRMPLIGDEAPSFKATTTQGEINFPKDYKGKWVVLFSHPADFTPVCTTEFMTFATMEDEFRELNTELIGLSIDG
    IHAHIAWLRTIKEKIEYKGMKDVEVNFPVIADIKMEIAKKFGMVQPGASDTQAVRAVFIIDPKNKVRAILYYPLSNGRNM
    DEVKRLIIAMQKSDAEQIATPANWQPGDDVIIPPPGSCGMAKERVETKEDDKYCLDWFICFKKDKK

    >gi|294495262|ref|YP_003541755.1| alkylhydroperoxidase like protein, AhpD family [Methanohalophilus mahii DSM 5219]
    MKFLIDKLPETANAFADMRASLFKDSALDTKTKELIAVSSSVLMRCEKCVEIHASRAKDNGATEDEIAEAIAVSMFIAGG
    SQLHWTRKYDQIFENTNE

    >gi|294495313|ref|YP_003541806.1| methionine-R-sulfoxide reductase [Methanohalophilus mahii DSM 5219]
    MPEEWKQISEEEWKKRLSAEQFRVLRKKGTEAPFSGKYNDFYENGIYTCAGCGQEMFSSSSKYDAGTGWPSFWEAISEDN
    IERIPDYSLGMKRIEVICSRCGGHLGHVFDDGPAPTGEHF
    CIDSISLDFNPE

    >gi|294495385|ref|YP_003541878.1| UBA/THIF-type NAD/FAD binding protein [Methanohalophilus mahii DSM 5219]
    MNEFTEEQIKRYSRHIILQEVGGEGQQKLLSSKVLCIGAGGLGSPIIQYLAAAGVGTIGIVDDDVVELSNLQRQVIHGGN
    SGIPKVESAKYFVKKLNPDVDVITHNERINPDNISDIINDYDIVVDGSDNFATRYLVNDACVLGKKPLSHGSIFRFEGYV
    TTILPDEGPCYRCLFEHAPPAGMVPS
    CQEAGVIGVLPGIIGVIQATEVVKYLLGLGDLLVGRMIYYDALNMSFDEIKIRK
    NPSCPVCGQNSKIKSIKYENYQDTQLCTY

    >gi|294495481|ref|YP_003541974.1| redox-active disulfide protein 2 [Methanohalophilus mahii DSM 5219]
    MKIEILGTGCAKCKKTFEVVEKAVKEAGIEAEITKVEDINSVMDYGVMVTPAVVVDGDVKIAGKIPSIDDVKEWIL

    >gi|294495624|ref|YP_003542117.1| formylmethanofuran dehydrogenase, subunit G [Methanohalophilus mahii DSM 5219]
    MASVMEIYQLLPKTNCKKCGKSSCMAFAAALLSREKNLDECTPMLEEDKYSENYTKIKSLVSPAEQASETGMIVHEDRCT
    GCGNCVVACPVNVAEDSKGAGSGNAPTNERVILRVEDGVVRLSNVEDCRRFGENKILCSGCIVTCPTKAIEFV

    >gi|294495626|ref|YP_003542119.1| thioredoxin [Methanohalophilus mahii DSM 5219]
    MMGLGNFIKGLFGKGEPAMSTSEPVTETISTNLYKVNSLAFEQEVVKAETPVIVDCFAKWCAPCKKMAPMFEEVAAEYEG
    KVKFVIIDLDKSKDIAKQYNVVGIPTLLLFEKGEVKEKLVGNTTKDKLKASIEEVLGIKSE

    >gi|294495627|ref|YP_003542120.1| CoB--CoM heterodisulfide reductase subunit A [Methanohalophilus mahii DSM 5219]
    MRIGVYICHCGLNIAGVVDIETLLKQVESLDDVVVASDIQFMCSDSGQEKITKDIEEHDVERVLVAACTPKLHETTFRNV
    LEKSGINPFLLEIVNIREQCSWVHMENPRMATQKAFDLIKMGVAKLRFLKPLKIQSTPVSKEVLVIGGGVAGIEAALNLA
    DTGYKVHMIEKEPTIGGKMALLNEVFPTNDCSI
    CVLAPKMTEVVNHPDIELHTLSEITAIEGSVGNFEVTGITQPRYVSE
    EKCKGCVDECSRVCPVEIPSRFDSGLGKSRAINIPIPQAVPQVAYIDGDYCVGCGLCAQACPADAVEFEQQTTQFQLNVG
    AIIIATGYRLFDASRKEEYGYGIYPDVMTNMELERLLNASGPTRGRVTCPSTGEVAEEVAFIQCVGSRDESVGNPYCSRV
    CCMSAMKNAQLLKERYPDIRITIHYIDIRASGEMYEEYYTKTQAMGVDFVRGRVAEIVQEHDASLSLRYENTLESRIEEK
    QYDLVILSTGMEADPSAKPIGSMLKMAKRPDRFFAVSHPKMKPVDSHINGVFLAGCASGPKEIQVSIAQGSAAASRAIRL
    LHPGELRTDPLSAHVDYDTCIGCGVCTDVCDYGTIKIENGKAFVDEVSCHGCGTCSAACPVDAISMHNHTDEQVRAQIKA
    ALEVKDEFPLIVAFLCNW
    CSYASADLAGTSRIQYPTNVRIIKVMCAGRVDPDFVMEAFEMGADGIFVAGCRLGECHYVHG
    NYHAQTRMENLGETLSKEGFDSGRLRVEWISAAEGEKFASTIEDFVDYLKAIGPIGSELEEADR

    >gi|294495662|ref|YP_003542155.1| peptide methionine sulfoxide reductase [Methanohalophilus mahii DSM 5219]
    MSLKSIEKATFAAGCFWGVEAAFREVEGVISTQVGYTGGSMSNPSYKEVCTGRTGHAEAVEVTYDPQIVSYEQMLDIFWN
    IHDPTTPNRQGPDIGTQYRSAIFYHDIKQKEIALRSLHKLQESGKFNTIVTEIKPASEFYPAEDYHQQYFEKKGICRSGK
    CGWK

    >gi|294495676|ref|YP_003542169.1| heavy metal translocating P-type ATPase [Methanohalophilus mahii DSM 5219]
    MAEILLHVSGMSCGHCTKSVHDALEKLEGVKSVEVNLDSGIATINYDPSSTSVETMKETISQAGYSVEDQEENACEGTCP
    VSIEEISKQDAEKTLSLNIYGMS
    CTACAKRIETGLEKVDGVREVSVNFASEKASVTYDTNKLDLREIRDRIESLGYGIRS
    DRLTLNITGMS
    CASCVSNVEKALKNQPGVLEANVHLSLEKADIIFDSSIMDPEGLIKVIENTGYGASIPEDTKNNLKDKQ
    EQERIEQQKNVLIAFALTLPLTLGAMQGMLRIDPYVPDILANNIVQFTLATLTLVFPGRQFFTGAFRGLQHGSADMNLLV
    ASGTGAAFIASTAAAFLNLGAGYEHTYFDSAAMLITFILFGRYLEAKSRGKTSEAIRKLMGLRAKTARIIMDGEEKDIPV
    EEVKPGDIVVIKPGEKIPVDGEVIEGDSAVDESMITGESIPVEKSTGDTVIGATINKTGSFRFKATKVGADTALSQIIKL
    VERAQTSKAPIQRLADIVAGYFIVIVMTIAMLAFFFWFFIGYGTFNVAELTGVASPFLFALLIAITVLVISCPCALGLAT
    PVAIIVGTGMGAENGILIRDGESLETTPKVDTIVFDKTGTLTIGKPFLTDVATTGNYEENYLLQAAASVEKLSEHPLAEA
    IVEGAKSRKLQLKNISGFESFSGKGVAGEWDDHSVIIGTKRLMEEKAIYPGDVANYSNRFEDEGKTAILVAIDGTIAGVL
    AVADVLKEEAPSVIAQLQEIGLGVAMITGDNSKTAQAIARQAGIDTVLAEVLPADKAAEVEKLQKQGKRVAMVGDGINDA
    PALSQADVGIAMGAGVDVAIESADIVLIKNDVKDILKALNLSKLTMKKIKQNLFWAFGYNTLGIPIAAGVLFPVFGQTLI
    TPAMAAAFMAMSSVSVMTNSLLMKRKRIE

    >gi|294495720|ref|YP_003542213.1| 3-Cys thioredoxin peroxidase [Methanohalophilus mahii DSM 5219]
    MTIRIPMMGEIAPSFRARTTHGEVNFPKDYEGRWVIFFSHPADFTPVCTTEFIMFAKMQAELRQLNTELLGLSVDSVQSH
    ISWLRSIKEKVEFNDISGIDVEFPIVEDQGLSIVKKYGMLQPSENKRYMRYIQDIQDIRANKATDENEIINTQPVRGIFI
    IDPESRIRYMAFYPISNGRNLDEIKRILQAIQKTDSEKVDTPVNWNPGDDVIVPTPLSYEDAKKRMEDKELKCSDWYICL
    KKDKT

    >gi|294495733|ref|YP_003542226.1| beta-lactamase domain protein [Methanohalophilus mahii DSM 5219]
    MIFERIKSEGIAHLSYFLGFGKEAVVIDPRRDCQIYVDLARQNGMNIKYIFETHRNEDYVIGSQQLKTLTGADIYHGIYL
    DFEYGNALKDKQNFTFGSLKLTALHTPGHTDESMSYVLSDLNSNEVPVMVFTGDTLFVGDVGRTDLNGPDKTSQMASKLY
    DSIFNKILPLGDEVILCPAHGAGSVCGGAISQREHSTLGLERIHNPVLQKTDRDEFVKHKLAEHHEYPPYFRKMEEYNLR
    GPPILECLPIPKMLSPQEFREEMEKGAVVVDTRMPHSFGGAHIKDTYSIWLEGLPSFAGWVLSYDKPILLVMEEKEQLDK
    AVKYLVRLGYDNIKGFLEGGISAWYMEALPVDGFHLISVHDLKRKLDENERMVILDVRGQDEWEAGHIKRSTHIYVGNLE
    NNLDKLPDKCQVVVY
    CGSARRSNIAASILKRNGYKKIYNVLGSMAAWKTAGYEIVK

    >gi|294495807|ref|YP_003542300.1| Thioredoxin domain protein [Methanohalophilus mahii DSM 5219]
    MNQSINSFCHRQYTAGYCCTERKTDPCYGIPAHMSSHCRAIEPHFREYSKQYGDSVNFVMVNPRENPGIATRYNIRGTTT
    FLYFCDGNLIKTHVGAMHPANLKRSIDEMIHNGSECAKRTTALDYDISLYE

    >gi|294495857|ref|YP_003542350.1| thioredoxin reductase (NADPH) [Methanohalophilus mahii DSM 5219]
    MYDLIILGAGPAGVTAAIYAVRYGLDTLLVDKDSMSGLISTAKTVENYTGFPSIGGMELMEKFLDHAEKAGVTSKVMEIK
    SVTEEGDDFIVSSSEEELKSKSLIVATGSSPRELDVPGEKDFLGRGISY
    CATCDGPFFSGKEVAVIGGGESAVTDAIFIS
    DIASKVYVVHRRDKLRASQILQDRAFDRPNIEFVWDSVVDAIEGKDVVESLQIHNVITEETKKIPVNGAFIYIGLNPNTD
    FVNVKKNDKGFIITDESMATSARGIFAAGDCRQSPLYQVITAASDGAIAAYSAFKYIEGI

    >gi|294495858|ref|YP_003542351.1| glutaredoxin [Methanohalophilus mahii DSM 5219]
    MPKVILLYASWCHNCPKAEKIWRDLKEEHEFEYEEVDVESEEGQKIAQEYSVMAVPTTVIDGEVAFIGIPSKDEALESIK


    >gi|294495923|ref|YP_003542416.1| formylmethanofuran dehydrogenase, subunit F [Methanohalophilus mahii DSM 5219]
    MNETVISTKDNKQVVYIPEKCIGCGTCVMVCPKETLVIGSVGPVARGLIDKEFLEIRPNTCITCGMCSKVCPTGALEMRE
    DGKPVEEKTYLINAIKPTTVNDDCVHCGLCEQVCPQGCIEVDQWLSNDNAAKVDGQTTIDQECCVHCGWCESVCPVDAIE
    VEKPFEGTWFRDEDVCQACRTCVDVCPCNALFNPDWEAGERVDKVAQRPDACIYCGACAVSCPVQAIDVRKTAIAAEMEK
    KKVFEKKLLDKPSVKPTLTSKLVTDEYDCLGCGNCVIVCPVNAYANKELAAGHLNNMDEKALLEVENGAVNVVDQDVCGS
    CGACAMICPTNAIWLEKREVE

    >gi|294495951|ref|YP_003542444.1| transcriptional regulator, ArsR family [Methanohalophilus mahii DSM 5219]
    MMLHEKAKFFKALGDQTRLAIIGCLLKHDHCACDFATITGKDQTTVSRHLKILCEAGILKYEKDGRYVIYSIMDDNMKDK
    LENCGIEKLDSCCSDNAADADAKKNVVKEKYGKIALDVVQGCGCCGDLTKEEVSTSIGYSFEDTQSFSAANLGLGCGNPT
    AIGEIKEGDVVLDLGSGGGFDSFIAARKVGKTGKVIGVDMTEDMVAKARKNAEKYELDNVEFRQGDIESLPVEADSVDVI
    ISNCVINLAPDKSRVFREAYRVLKNDGRMYVSDMVLLNDLTPEQRNDEDLICA
    CIGGALLKDDYLGTIKDAGFTVQIIDE
    DKDISENQYSGYPVMSLKLKAFKAEVGRA

    >gi|294495952|ref|YP_003542445.1| 3-Cys thioredoxin peroxidase [Methanohalophilus mahii DSM 5219]
    MEQNEYMNTRIPMMGEFAPSFRARTTHGEVNFPKDYEGKWVIFFSHPADFTPVCTTEFIMFAKMEAELRQLNTELLGLSV
    DSVQSHISWLRSIKEKVEFNDISGIDVEFPIVEDQGLSIVKKYGMLQPSENKRYMRYIQDIRANNATDENEIINTQPVRG
    IFIIDPESRIRYMAFYPISNGRNLDEIKRSLQAIQKTDSEKVDTPVNWNPGDDVIVPTPLSYEDAKKRMEDKELNCSDWY
    ICLQNDKT

    >gi|294496074|ref|YP_003542567.1| Rhodanese domain protein [Methanohalophilus mahii DSM 5219]
    MLDTEDLFLLDVRTQSEFDEGHIKYANLIGVTLLPSRLDEVPNKETVLVYCKSGTRSASASSTLIGAGYIDVYNMEGGIN
    AWKAAGILL

    >gi|294496138|ref|YP_003542631.1| Thioredoxin domain-containing protein [Methanohalophilus mahii DSM 5219]
    MYGFVLIVMLLAFMAAGCTTPEVNQQQETIVQESNTKDIEQLNTILEEEPVLIKFGSPTCAPCRDQDIILDSIADDYEGK
    ASVIMVNINEERDAASFFGVYSIPDMSVIAGIKDDRYLFMGPDGNVSFDRRSTRYVGLTDGNILRQTLDNAIAYRQNNTS


    >gi|294496165|ref|YP_003542658.1| alkylhydroperoxidase like protein, AhpD family [Methanohalophilus mahii DSM 5219]
    MAEHEKVVKDIEDKMGFAPNILHTLKEIDPNFVKKYRRCHDKLLSDGAMPAKYKILMALAVVASKQCEACTVSQMKSALK
    NGATAEEIMETMEVISITSGAPAVAACREALKLLQE

    >gi|294496209|ref|YP_003542702.1| alkylhydroperoxidase like protein, AhpD family [Methanohalophilus mahii DSM 5219]
    MTISMDDKKSNWEKDFSNLKDTIMQDGAIDNKTKKLLALASAVAVGCDECVSHHKNFARNAGLKDSEIEEAILVASLVRL
    GSGLRHVDQKEK

    >gi|294496338|ref|YP_003542831.1| electron transport complex, RnfABCDGE type, A subunit [Methanohalophilus mahii DSM 5219]
    MKLVEKALFAIFLEGAFIKNFLIIQFLGLCSFLGVTKDTKGAAGMSGAVIFVMTMASIISYGIYTFILDPLGLTFLRLIS
    FIVVIASLVQLVEFVVRKNIPSLYRSLGIYLPLITTN
    CAVLGVVLLNVMNEYSFLESIVFGISAGIGYTIVMVMMSSIRE
    RTSLVPVPAAMKGLPQAFIIAAFLSMAFINYFKVIPI

    >gi|294496339|ref|YP_003542832.1| electron transport complex, RnfABCDGE type, E subunit [Methanohalophilus mahii DSM 5219]
    MSKAFNEFIRGITKDNPVFALVLGLCPALAVTTSVDNAIGMSAATAFVLISANLMVSALRKQIPSTVRLPIFILIIATFV
    SIVEMVMEAYTPPLYEALGVFIPLIVVN
    CVIIGRAEAYANKNTVPYSLVDALGIATGFLFALVLIGGTREILGTGQIVVF
    GQMLIALPMVEPAAYMILPPGAFLTIGILMALINHRRAKKLARGE

    >gi|294496393|ref|YP_003542886.1| Rhodanese domain protein [Methanohalophilus mahii DSM 5219]
    MGKITTKQLAEDLDNYKVIDIRSIDAYNGWKEAAEARGGHIKGAKTLPYKWLHYIDWIEIVRNKGILPEDSLVIYGYDPQ
    KAEEVARQFEKAGYPDVTVFNNFLEWAEKDLPMEHLERYEHLVSADWLNQLITTNNAPEYSNNKFVICHSHYRNLFDYDE
    GHIPGAIPMDTNSLESPETWNRRSPEELKAALEEAGITYDTTVILYGKFSSPNNDDQFPGSSAGHLGAMRCAFIMLYAGV
    EDVRILNGGLQSWLDSGYEVTTVPSKNEKVSFGIDIPQKPEIAVDLEEAKEILASPDKNLVSVRSWKEYIGEVSGYNYIE
    KKGRIPGAVFADCGTDAYHMENYRNLDHTMREYHEIAANWKKIGITPDKRNAFY
    CGTGWRGSEAFLNAWLMGWDKAAVYD
    GGWFEWSSNNLPFETGVPEE

    >gi|294496496|ref|YP_003542989.1| alkylhydroperoxidase like protein, AhpD family [Methanohalophilus mahii DSM 5219]
    MDLDNIRKILEKDEDEAVSDVLSTVEERYGEVPYILNFMKDMPELLIPKVMYDNSIMREFERLDPETIELICVGVASALR
    CDH
    CLKMHIRVARRLGLTREQIFDAILIGGAISNASVLAEGTRALDDEVNGSSPSCDSDCDSCNITGSDR

    >gi|294496507|ref|YP_003543000.1| methylated-DNA/protein-cysteinemethyltransferase [Methanohalophilus mahii DSM 5219]
    MNMQNLCYDIMRYLAGEYVDFMKYDLDLTHLTKFQREVLEATRKIPYGQTRTYGQLAEDIGKSKASRAVGRVLNKNPYPL
    VIP
    CHRVVAKNSIGGYAGGKELKKKLLEMEKAIDYDESVR

    >gi|294496554|ref|YP_003543047.1| thioredoxin [Methanohalophilus mahii DSM 5219]
    MSNVVLYDFSATWCGPCKMQKPILENLEKELGDKVDIKEVDVDQSPDLAGKYGIQAVPTLIIEKDGSEIKRYTGVTSADI
    LSAELKKLF

    >gi|294496581|ref|YP_003543074.1| iron-sulfur cluster assembly accessory protein [Methanohalophilus mahii DSM 5219]
    MIEITEKAATELRTLMESEDKKDHALRIFVAGMGCSGVQYGMALDNETKEDDVTVTDKEIKIVMANDINEELSEATVDFI
    ETPQGNGFVIDNPSEMSGCGSCGGSCH

    >gi|294496583|ref|YP_003543076.1| dihydrolipoamide dehydrogenase [Methanohalophilus mahii DSM 5219]
    MGYNMIEYDLIIVGTGSGMNYVGSILQQNPEMKIAVVDKDEPGGICLTRGCIPSKMLLYPAELVREIKSAQKFGISAKIE
    DIDFKSIMDRMRNAIHSDIAMIREGLESDDVLDYYHGVAQFIAPYTLKVGAETLKAPMIFLCTGSKPFVPPIDGLDSVTY
    LTSDEVLNMESLPESLVIVGAGYIAAEYGHFFSAMGCRVTVIGSGPRVLQQEEPEISILARRKMEQYLDIHTGYRVVSVG
    QNNGMKKVTAINNEGDEISIEAEQILLATGRASNSDILHPEKGDIVTDEKGWIRVNEKLETTCKNVWAFGDCNGQQLFKH
    VGNYESTVVFQNAILRQDIKVNYHAAPHAVFSWPEIAGAGLSEAEAIEAFGEESISIGFEEFENTGKGLAMDLHDYFVKV
    IIEDNSQQILGIHIIGPQSSVLIHQVIPLMYVDGPQTHPLVHSMDIHPSLSEVVKRAFYSQYSIGEYHMILKEKELEKS

    >gi|294496618|ref|YP_003543111.1| thioredoxin [Methanohalophilus mahii DSM 5219]
    MDELEEIRKRRMEEIRTDLEKANWPAEAMIISDADFEDFVSRYPLVVVDCWAEWCGPCKRVGPIIDSLAGQMQGDVVFGK
    LDTDQNQLTARKFQITAIPTLLVFKNGQLADRMVGALPKANIQEKLKAFL

    >gi|294495571|ref|YP_003542064.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Methanohalophilus mahii DSM 5219]
    MSNKTVIIVHSGDMDKLYSALIIANGSLSMGMEASLYFTFWGLERLKKGGLEKGPLSKMNFLGLGKWMVKGRMKKANVAP
    LEKMMTDFKELGGKIIA
    CEMTMEIMGIKQEQLRTEWIDEYGAVGTYVHEAKDAEITLFI