Methanohalobium evestigatum Z 7303 uid49857

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|298674008|ref|YP_003725758.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanohalobium evestigatum Z-7303]
    MVGNTSENNTKKQDLVIIGGGAVGMAVATHVQRHGNYNIKVLSKDSHTAYSQCGMPFVLAGDIPDFNKLIVKNLQFFKDM
    GIDVRLNTQVNSIDLENHTVHTQIDTVRYDKLVIATGSSPSIPEPLKEFIKMDNVFTLRTLSDGIKIQNNLEKSKNLVVI
    GAGGIGVEIAVAGVKRGISTTLINRSKNVLSHNLDSDMSQILQNHLDSKGINLLTGHTPVSINGSDTAESVTIKENITGK
    IKNISVDTIVISTGVNPEVSLAKNAGISVGESGGLLVNNKLQVKYDNKYLDDVFAGGECAQVYDFVTGNPFVSQLASTAR
    RMASVIAENLLEKTSTFTPITNPWIGVIGDYQVGNVGLTEKTAYKNKINTVTGSSTGFTRAGYYPGGEKIYIKLLFSNRC
    LSGAQIIGRKGVKERIDGLSLAIRKKASIDDMLKMETCYTPPVSELVDPITYAVKDAYKNMDNQKYD

    >gi|298674025|ref|YP_003725775.1| iron-sulfur cluster assembly accessory protein [Methanohalobium evestigatum Z-7303]
    MVNITDEAASELKSLLESEEKEDHALRIFIAGMGCSGIQYGLALDNEIKEEDVTEESNGLKVVMSSDIEEGLSDATIDYV
    ETEEGKGFVIDNPNPASCGSCSSCQ

    >gi|298674051|ref|YP_003725801.1| thioredoxin domain-containing protein [Methanohalobium evestigatum Z-7303]
    MGKPILLDFSATWCGPCKMQKPIIDDLKEKYGDQVDIKEVDVDENGEMARNYNVMAVPTIVIEKDGEEVKRFTGLKQADV
    LSAELDKLL

    >gi|298674074|ref|YP_003725824.1| glutaredoxin [Methanohalobium evestigatum Z-7303]
    MSEIIIYTTETCPKCEQLKKLLKSNNISFKEADMSTPEALTELRVNGVFDVTAPILQIDDKFLTNDELFDGGEVDSNAIS
    DIL

    >gi|298674086|ref|YP_003725836.1| thioredoxin domain-containing protein [Methanohalobium evestigatum Z-7303]
    MKKLVLFTILSIFILSTIGCIESDTGAENNNNGYTSGGSDRVTSIQQINNTVENKSVLIEFGAEWCSACDRQRPIIEDIA
    NEYKDKAEVMYVNVDMTPDIAKRFNIRSIPDSVVVVDINSGGEYVYMTENGDTTIQREKARFLGVTQKQRLVKTLEYAIE
    NRTG

    >gi|298674110|ref|YP_003725860.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanohalobium evestigatum Z-7303]
    MINYDLIIIGTGSGMNFVNAIIDSNPEIKIAVIDKDAPGGICLTRGCIPSKLLIYPAELIRDIESAERFGINVDIQNIDF
    KNIMDNMRDKISSDINMIRQGLSESKNVDYYPESAEFVEPYTMKVGNETIYSDMIFICTGSKPVIPPVKSLNEVGYLTSD
    TVLEMDNLPGSIAVIGGGYIAAEYGHFFSAMGSNVTLIGRNPQFVPEEEPEISALATNKMSGYMNLYTNHEAVEVQNEDN
    KKKVIFKDRGSGEHKEITVDDILVATGRGPNTDILRPEKGGIETDEKGWIKVDDHLETSKPNVWALGDANGKYLLKHVAN
    YESNVVYQNAILNRNIEVDYHAVPHAVFSHPEIASVGLKEKEAVEIYGEDNIIIGFYSYEETAKGQAMKVQDDFVKIIME
    YSSEKILGAHIIGPYASILIHQIIPLMYTPDQSAAPIMDSMTIHPSLSEVVTNAFYFLMPVHHYHHILEHLGLDEYTGYR
    TGQ

    >gi|298674658|ref|YP_003726408.1| thioredoxin reductase [Methanohalobium evestigatum Z-7303]
    MNDLIIIGGGPAGIAAGIYAVRYGLDTYLLERTAIGGQISSSQEVENYPGFSSINGMELMNTFKAHAESIGVPIENKGVT
    GVRPEDDKIVLSTDENVDIEAKAVIIATGAKPRKLGIPGEDTYYGRGVSY
    CATCDAPFYKERDVIVVGGGNTAISDALIL
    SNVANKVYQVHRRDELRASKVLEDRARSRDNIEFLWDTVLEEVKGNNFVESALLRDLNTNELSEISIDGVFIYVGIDPNT
    DLIDVEKDESGFIITNEFMETSVEGIYAAGDCRKSPLWQVITAASDGAIAAAKAYEYIRNKG

    >gi|298674659|ref|YP_003726409.1| thioredoxin [Methanohalobium evestigatum Z-7303]
    MVKVTLLYAKWCHVCPSAIKLWEDLHSKYDFEYKELDVDSEEGQDVISEHGIRGVPATIVDGEVAFIGVPDKDKAIKAIT


    >gi|298674699|ref|YP_003726449.1| methionine-R-sulfoxide reductase [Methanohalobium evestigatum Z-7303]
    MHKVEKSEEEWKKELTPEQYYVLREKGTEPPFTGKYYQNKRKGIYRCAGCGQELFSSETKYDSGTGWPSFWAPISEDRIE
    TKTDYSFSMERTEVMCSRCGGHLGHVFNDGPQPTGKRY
    CLNSVALDFKEE

    >gi|298674701|ref|YP_003726451.1| type 11 methyltransferase [Methanohalobium evestigatum Z-7303]
    MKNKDIKNVVKKEYSTIAKNNNSCCGSVSCCGSRESPEEISKLVGYTEEDLKNVPRDSNLGLGCGNPVYLASLKKGEVVL
    DLGSGAGFDCFLAADKVDEDGLVIGVDMTPDMVEKAKNNAVKDNYTNVEFRLGEIENLPLDDNSVDVVISNCVINLSPDK
    EKVFNDVYRVLKPDGRLVVSDIVLLQDLPESIRNSIEAYVG
    CISGALKKEDYLDLIEKAGFKDIQIIDESEFPHDALSSV
    SDEYDIFRYAESIVSIKIKASKII

    >gi|298674702|ref|YP_003726452.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanohalobium evestigatum Z-7303]
    MKKYDVVVIGTGTAGSTVAHKCNSAGKNVAIIDHRPFGGTCALRGCDPKKVLVGGAELVDWNNRMKETAGLDRDTTINWT
    SLISFKRTFTQAFPDMIEKNFTSHGIDAYHGLACFSDDKTIEVGDDQIEGDYIVIATGSKPRELNILGEEHIITSDEFME
    LENLPGNVVFLGGGYISFEFANIAARAGSKPLILQRGENPLKTFDSDMVDVAVEASKDAGIDVLTGHKVTKIEKKGNLYE
    VTTENEKQNTFTTDLVVHGGGRSANIDELGLDKGNVEVHKKGIAVNEYMQSPSNPRVYAAGDCTEEGPQLTPVAGLQGDT
    VAENIIKGNNKQVDYTGIPAVVFTLPPLASVGITKDDVKDTHEVIYNDRSSWYSSKRLNFNHAASKIIIDKQTDKILGAH
    ILGPEAEEVINIFAMAMRYGLNASDVKNAVFTYPSVCSDIEHMM

    >gi|298674853|ref|YP_003726603.1| rhodanese domain-containing protein [Methanohalobium evestigatum Z-7303]
    MNISCSTEDVTKISPEKLKQMLDNDREGINILVDVRQPEEYEQSHIPGSKLVPLDELDARYDELDKNKNIITYCRAGRRS
    LGAATYLCNLGFQNVYTMDGGILEWNYETLSGYPEEKPEFITGNEQIKDILLTALKLEKGAQDFYLRAKNNEISSNIRQT
    LDKLSQFEDAHMNRLYRRYANTVEEDIPELEVLKKELDFEYMEGGIKLSKELLKSDEKFKDEIDVLETAIEKEYLSFDFY
    KRMAEIMSDKNTRKLLHELASEEKNHITYLTNNLKKII

    >gi|298674854|ref|YP_003726604.1| rhodanese domain-containing protein [Methanohalobium evestigatum Z-7303]
    MYFKKIKSEGLAHLSYFIGSENEAIVIDPRRDCRIYTEIAFEQNMNIRYIFETHRNEDYVIGSVELANLTGAEIYHGKYL
    DFKYGNSVEDGSEFYFGSLKITAIHTPGHTDESVSYLLSDTDTGKEKIMVFTGDTLFVGDTGRTDLYGPDDAPRLADNMY
    ESIFEKIVPLGDHVILCPAHGSGSVCGGFISEREESTVGVERLQNPSLQVKNRDEFVKLKTSEKHFIPPYFKKMEEYNLK
    GAPLLNSKYPPSLPPHEFRKQIHNGALILDTREPVSFAGCHIKDSYNIWLDGVPSYAGWILSYKKPVLLVMEEKKHLDTV
    LRYLLRLGFDNIAGYLRGGIESWYNESFEIEKSGLMDVHKLREEIKNNNLNVLDVRRNDEWNSGHIKSAVHIYVGELENR
    IDEVPDSKPIAVV
    CNVGKRASLATSILKKNGFDDVYNVMGSMTAWNNAGYETEK

    >gi|298674925|ref|YP_003726675.1| redox-active disulfide protein 2 [Methanohalobium evestigatum Z-7303]
    MKIEVLGASGCSTCSKLKENIEKIVSEMGKSSEVEIVKIEDPVEIAKRGIMKTPVVVADGEVKFKGKVPSDDEIKEFLQ

    >gi|298674969|ref|YP_003726719.1| thioredoxin [Methanohalobium evestigatum Z-7303]
    MEDLEELEEIRKKKIKEIQKSMERRSYPSKPFDVTDSNVDETVSKYPLVVIDCWAEWCGPCKKIAPAIEELASEYQGKAV
    FAKLDVDNNQESAKKFGISSIPTLLIFKNKVLIDYIIGAVSKQDIIKRLQPHM

    >gi|298674971|ref|YP_003726721.1| heavy metal translocating P-type ATPase [Methanohalobium evestigatum Z-7303]
    MVIKTTIKVYGMSCKHCVKSVTDAISELEGVESVDVDLENEWAIVTFDSETVNLDDIRQAVTDAGYQPGEEVDETGNTQT
    CPVEGEESQESGTCPIVTEEEETEEPGHYATSTLDINFKVTGMT
    CASCAKNVEKVLKKQSGVVSATVNIALEKASVTYDP
    SVVSSKELKDAVVSIGYGVERDTIDLNIGGMT
    CASCAKNVEKVLKKLEGVESVSVNLPLEKAHLVYDSSLVSVTDMKSAV
    EDIGYSATSEKKELESDREREARETEMKQQRTNLIIAAALVLPISLGDMSTAFPNILWFVPPFLANEILLFLLTTIVMIF
    PGRQFFTGTFEDFKHGVTDMDLLIATGTGAAYAVSVAATFFNLGPGYDETYYHTAAMLITFIVFGRYMESKTKGKTSEAI
    RKLMGLKAKTARVIVDGEEKEIPVEDVEIGNIVVVRPGEKIPVDGEVTDGSSAVDESMITGESIPVDKDPGDTVIGATIN
    KSGTLKFRASKVGSETALAQIIQLVENAQSSKPPLQRIADVVAGNFILAVHIIALVTFMVWFLIGYEAFDVSLFSNITSP
    FLFSLLIAITVLVISCPCAVGLATPAAIMVGTGKGAENGILIKTGEALERAQKLDTIVFDKTGTLTVGEPELTDVVGTDD
    YSDDEVLRIAATVEKGSEHPLGEAIVKGAQARDINLKTAENFKNIPGHGVEASLEGKRILLGTRKLMDDNDIDISGLDKK
    MEEFENDGKTAMLIASDNTAIGVVAVADTLKENSKHAVDKVHKMGIEAIMITGDNKRTAEAIGRQVGMDRVLSEVLPEQK
    ASEIKNLQNEGRVVAMVGDGINDAPALTQSDIGIAMGAGTDVAMESAKIVLIKNDLIDVIASIRLSKLTMRKIKQNLFWA
    FGYNSVGIPIAAGILYPFVHQILISPAFAAALMAMSSVSVTTNSLLMKRGSIKE

    >gi|298675032|ref|YP_003726782.1| hypothetical protein Metev_1104 [Methanohalobium evestigatum Z-7303]
    MNEETGETGKHPNHLINEKSPYLLQHAYNPVNWYPWGDEAFEKAKNEDKPIFLSIGYSTCHWCHVMENESFEDPEIAQIL
    NDNFVCIKVDREERPDIDSTYMDVCQALTGRGGWPLTIIMTPEKKPFSAATYLPKESRFGLTGLIDLLPRISDMWSKQKR
    ELVSRAEQITSSVEEVFTKSPKTRELSNQELDSAYESLLENYDPEYGGFGNAPKFPSPHNLMFLMRYWERTSNNKALEMV
    EKTLKNMRIGGIYDHIGFGFHRYSTDRYWMIPHFEKMLYDQALLSMAYIEVYQATGKIEYKNTARDVFTYALRDLTSKEG
    GFYSAVDADSEGVEGKFYTWTYDEIHKILSKSEANIVTNLFNIKKEGNFRDEKTGNLTGKNIPHLIETPLYIDVEPDEEL
    DEFHEKLNEAREKRGAWKRNLLKTIYSQRRLEVARRKLFEARENRVHPAKDDKILTDWNGLMIAALSKGAQVFNDKEYAN
    SARKAADFIIKNMSDSSGQLMHRYRDGDSDIHGFIDDYAFLTWGLIELYETTFEVKYLEKALEFNNYLINHFWDDNNGGF
    YFTPDNAETPIVRKKEIYDGASPSGNSVALMNLMRLGRMTGNPELEKKASDSIKSFSKSLSRNPIASTHSMQALDFVQGP
    SSEVVITGDFQSEDTQNMINSLRTEFIPRKVVLFKPDKVQSPDIVNIAGFTRDMDSQEGKATAYICQNYSCSSPKTDADD
    MVRSLKNI

    >gi|298675059|ref|YP_003726809.1| peroxiredoxin [Methanohalobium evestigatum Z-7303]
    MKENENTQEESNYHSMPLIGDNAPAFKADSTVGEINFPNDYKGKWVIFFSHPGDFTPVCTTEFLKFAHMQEEFKELNTEL
    LGLSIDSIYSHITWLKSIRDNIKYKGYGNIDITFPIIDDLNMKVAQKYGMIHPKAKWSQEEVMEQLRTTGKSKSKDSFST
    HTVRAVFIIDPHAIIRATIYYPLSNGRNLDEIKRLILAMQKSDEENVQTPEGWYPGDDLIINPPKTYESAIERIKEEGSY
    CPEWYFCLKKDKTERNKHSERYED

    >gi|298675209|ref|YP_003726959.1| alkylhydroperoxidase-like protein [Methanohalobium evestigatum Z-7303]
    MNAIEETLNEQGLDLDNIKGNIMGDGAVSSRTKKLLTIASAVATGCDECVEKHKKEAKDAGINDDEISEAILVASLIRFG
    SGIKYLL

    >gi|298675278|ref|YP_003727028.1| peroxiredoxin [Methanohalobium evestigatum Z-7303]
    MDESNTQEQTSLPLIGDDAPKFTVNTTQGKINFPDDYNGKWVILFSHPADFTPVCTTEFMTFANMQEEFRELNTELIGLS
    IDSNFSHIAWLRTIKEKMEYKGMKNVRVGFPVIEDLKMEVAKKYGMIQPNASTTQAVRATFIIDPHAKIRAILYYPQSTG
    RNMDEIKRMIIAMQKTDKEHIATPANWNPGEDVIIPPAGDYDTAEQRAESTEEGTYCLDWFICFKKESGK

    >gi|298675335|ref|YP_003727085.1| Fe-S cluster domain-containing protein [Methanohalobium evestigatum Z-7303]
    MANAMEIYQLLPKTNCKKCGKSTCMAFATALLSGELRLDDCPEILEDKYKQNYEKLSELVAPIENASETGMIIHEEKCTG
    CGNCVVACPVNVAEDPEGTGIGLAPKNDRVILKVVNGVVQKGNIHNCRRFGENKILCNACIETCPTKAIEFV

    >gi|298675341|ref|YP_003727091.1| methyl-viologen-reducing hydrogenase delta subunit [Methanohalobium evestigatum Z-7303]
    MKIGIYICHCGLNIAHVINMDTLQDKIKKEFKDIEIVRDIQFMCSDTGQEAIIEDIKEHNIDRVLIAACSPKLHEKTFQQ
    VIENAGVNPYLLEIVNIREQCSWVHKQHPEMATQKAFDLIKMGVAKLKNLEPLEVKKVSINRNVLVIGGGVAGIEAALNL
    ADAGYHVYMVEKEPSIGGKMALLNEVFPTNDCSI
    CVLAPKMTEVSNHPNIELYTNSEITEITGSVGNFTVKGLKKPRYVS
    EDKCKGCIEECSSVCPVEISNPFDYGIGKIKAISMPFPQAVPQCAYINDEYCVGCGLCRQVCPADAVDYEQKEEEFSFDA
    GAVIVATGYNVFDASRKEEYGYSKYPDVITNMELERMINASGPTHGKVVVPSTKEIPQKVAFIHCVGSRDETVGNPYCSK
    VCCMSAIKNAQLLKERYPEMDIRLHYIDIRASGEMYEEYYTNAQSMGIQFVRGKVAEIQEDNSGKPVLRYEDTLENKIFE
    ETYDLVVLSVGLEANKDEKISSMLNLSTRSDGFYTVSHPKMRPVESNIDGVYIAGCASGPKEIQISIAQGSAVASKAMQL
    LSRGELETDPMSAFVDTDKCTGCGICQDVCKFGKIKLYNHKAEVDELSCHGCGSCSAACPEDAIYMRNQTDAQIHSQIEA
    ALEVKDEFPLIVSFLCNW
    CSYACADLAGTSRIQYPTNVRIIRVMCAGRVDPEFVLTAFEKGADGVMVSGCRLGECHYVYG
    NYNAKQRMDVLKDVLEEIDINPNRLNVEWISASECNRFAESIENFVEELEKIGPIGSEILEAPNAEHTG

    >gi|298675342|ref|YP_003727092.1| 4Fe-4S ferredoxin iron-sulfur-binding domain-containing protein [Methanohalobium evestigatum Z-7303]
    MQNTPDENENSDKNTIKVTKDMDVQGSHFIYKQFTEKSRKELDYDYKRCTGCGLCVKICPTQALELGPMHEIATGMDAPP
    VTLDIEKCTFCGMCAKFCPVNAFKMEISGEVPSEDSYPEFDSYVKINNNCLPCLLCESSCPEDAIEVKLNIPKKEDITPF
    DENAEGEIEIDTEKCNLCGLCSHFCDAFIMLEKEPSPTDPSPFEQLMVDEDECDY
    CMLCQDICPEDAIKVKGKKPCEPPA
    IEGEVHIDEDKCTRCGWCREVCPYDAVEIKKPFEGEITLKENNIKRCDPHGCQACFNVCPAHLWYVPEDKNIAIKEDYCI
    YCGACENACPENVMSVKRTQVHHTKIPDAPWASQWEDAIESMITSKRKHPDTSRTVEVEKEPSKEHEEVEFPEIDESLLK
    AARERINSTKPALKNINVRRKWEKESSEETRKEFREKFKNKKEGNSK

    >gi|298675433|ref|YP_003727183.1| peptide methionine sulfoxide reductase [Methanohalobium evestigatum Z-7303]
    MEKATFAAGCFWGVEAAFRQIEGLLSTRVGYTGGTWENPTYKDVCTGKTGHAEAVEVTFEPSIVSYEKLLDVFWKIHDPT
    TLNRQGPDIGTQYRSAIFYHNEEQKKKAIESRDKLQQSGKYKKDIVTDIVPASEFYEAEEYHQRYFEKHGYSACRI

    >gi|298675585|ref|YP_003727335.1| geranylgeranyl reductase [Methanohalobium evestigatum Z-7303]
    MQDVIVVGAGPAGSTAAEYTAKAGLSTMIIEKDSLPRDKTCAGGISSQALKHLDYDVPVNLVKRQCFGARVLYGNQVLES
    RSDELIASMVSRKEFDNYLTTKAVNSGTKLLQKTRVKSLDIKSNHVEIHTTAGVFKTKVVIGADGVNSVCARYVRAQLKP
    DETAFSLASDIPLSKEYIDMNYPDIVEFHFDKIKKGYGWVFPKDDYVSVGIGGIDAAKSSDSLKSYYEFINNFGFDYIKP
    SGHFLPIGGVERKTYNNRVLLTGDAAGFVDAFLGEGINYALMSGRLAAETVVDAFYKNDFSKAMLSKYQDKCKHEFGDDL
    KYSYIVSKVFYRHPDIFAKMLATNEKMLYRFIHLVTGNSGYPSFIKWLVPRIPYYTAKNFIPL

    >gi|298675692|ref|YP_003727442.1| methylated-DNA/protein-cysteine methyltransferase [Methanohalobium evestigatum Z-7303]
    MSTVRIDLLCQDFVKYISGRKRDFSEYDLDLSHLTEFEQMVLNETREIPYGETITYSELAKRIKKPRASQAVGKVLSKNP
    YPIVIP
    CHRVVSKSGLGGFGGGFNPQKLEEKKKLIELEKNYKKDKI

    >gi|298675702|ref|YP_003727452.1| alkylhydroperoxidase-like protein [Methanohalobium evestigatum Z-7303]
    MEFEKIKEVLDKEPDDAVSELLDDIKEHYGEVPYILDFMKNMPELFVPKVMYDNSIMREFKRMDPETVELISIGVSSALR
    CEH
    CLKMHIRVAKRLGLSKEEIFDAIMIGGTLSNASVLAEGTRALDSELGEDDKDKQETGCQKGDVCDLAGNNDDNSKDW
    SS

    >gi|298675754|ref|YP_003727504.1| heavy metal transport/detoxification protein [Methanohalobium evestigatum Z-7303]
    MSEVTIKIEGMKCAGCQENVENALNSVNGILSVNINLEEGSATVNYDPEKTDIDKIKSAVSNAGYKAK

    >gi|298675840|ref|YP_003727590.1| RnfABCDGE type electron transport complex subunit A [Methanohalobium evestigatum Z-7303]
    MAEDSILSVLMQGVFVQNLILIQFLGLCPFIGVTKDTKSSAGMSLAVIFVVTMASVATYFIYTFLLDPMGLQFLRIISFI
    VVIASLVQLVEFVLRKMSPAVYRSLGIYLPLITTN
    CAVLGSVLLNIRAGYDFAQSVTFGLAAGIGFTIVLLIMAGLRERS
    SLVHVHSSVKGVPHAFFFATLLSMAFVNYFEVIPLGG

    >gi|298675841|ref|YP_003727591.1| RnfABCDGE type electron transport complex subunit E [Methanohalobium evestigatum Z-7303]
    MGVWDEFLRGITRDNPIFGLVLGLCPTLAVTTTLENAIGMSAATAFVLICSNVLISTFRKQIPAVVRIPIFIMTIATFVT
    IISMVMEAYFPSMFAALGVFLSLIVVN
    CVIMGRAEAYASRNNTLYSFIDALGISAGFLVALGVMGSIRELLGTGEIVTFG
    YQLISVPIDPLDYMIFPPGAFLTIGVLMMLVNHYKAKKLERGE

    >gi|298676017|ref|YP_003727767.1| carboxymuconolactone decarboxylase [Methanohalobium evestigatum Z-7303]
    MTDEKEEHLEPDDLLKEMGEKIGYTPHILEILGELDPDHLTRYNACNKRILSDGEIPSKYKVLMALAVVASKQCERCAQT
    QMINAINHGATKEEIMETMDVIGITSGAPAVAACRDALKLLQKETE

    >gi|298676071|ref|YP_003727821.1| glutaredoxin [Methanohalobium evestigatum Z-7303]
    MEKVFMYTLSTCPWCKKTKKFFEKRKIPYDYVDIDKLKDENEKERIIEEMKREAGSTATPFVIIGDEVIIGYKPKKYAEL
    LGIEE

    >gi|298674923|ref|YP_003726673.1| UBA/THIF-type NAD/FAD-binding protein [Methanohalobium evestigatum Z-7303]
    MISENEQNLYSRQIMMFGEEGQEKLKNSSVTITGSGGLGSPIAIYLAAAGVGKIRIIDHDTVALSNLNRQILHHHKDIGV
    LKVDSAKGKLNDLNPNIDIETFNETLSPDNIKNLIGKSHIVVDALDNYHTRFSLNEAAVQEQIPLVHGAVEGFHGQVTTI
    IPGETP
    CMRCFISKTPPKKTFPILGTTAGIIGTMQANEVIKYLTGSGKLLTGRLLLWDGFNSKTEEVPVNKNQYCEICAT
    E