Methanoculleus marisnigri JR1 uid58561

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|126177970|ref|YP_001045935.1| redox-active disulfide protein 2 [Methanoculleus marisnigri JR1]
    MKIEVLGTGCAKCKRLAKNVEAAIKDLGIEAELVKVDDITEIMDRGVMLTPALAVDGELKVSGRVADVKEIKEILQG

    >gi|126177971|ref|YP_001045936.1| redox-active disulfide protein 2 [Methanoculleus marisnigri JR1]
    MVLVEIFGTGCARCKRMNRNVEIAVGDLEIDAEIRKIESLDAMIERGVMLTPALYVDGEAKVVGHVPCVEDIKQILLGEK


    >gi|126178114|ref|YP_001046079.1| peroxidase [Methanoculleus marisnigri JR1]
    MEPEELLQMPVIGEKAPEFDVLTTHGRLKLSDLKGKWVILFSHPADFTPVCTTEFMAFAAIADELKELDVQLVGLSIDSV
    HSHLAWVRNIKEKMGVEIPFPIIADLDMKVAKRYGMLHPGQSTTSTIRTVFFIDDKGVMRAMLYYPMFNGRSMPEILRLT
    KALQTSDEHGVATPANWEPGAKVIVPAPKTPEEIEKRMQEGYECKDWYLCFKEL

    >gi|126178121|ref|YP_001046086.1| glutaredoxin [Methanoculleus marisnigri JR1]
    MLNTVPEIFPFMAGVKVYTTENCPYCRMVKAFLRKHDIEHEIVDVGKDREAAREMIEISGQRGVPVTVSGDEVVVGFDAK
    RLRELFGTALEETVYDAVIVGAGPAGLTAAVYCARKLMKTVVIAENIGGQAAWSWAIENYMGFSTISGEELVRKFEEQVR
    GFDVRLELESVGDVRKEDDTILVRTASGTVYRSRTLILAPGKEPRRLGLPGEDRLMGKGISV
    CAICDAPLYRDKPVAVVG
    GGNAALQTAIEMTKFASSVTLIARRDLRCDEVYVDRAKKAGVRTFSHHEVTALHGDAGLTGVTVRDRETGEETGLDVEGL
    FLAIGLAPNTGFLKDLVVLNEQGEIDIDENGHTSVPGVFAAGDATCVKAKQIIVAAGDGAKAALEAHEYFEGEPEEEQIV
    CT

    >gi|126178178|ref|YP_001046143.1| thioredoxin [Methanoculleus marisnigri JR1]
    MEGERPLDDELQRLREERLRKLEERLTGTPGGVIEIADDAFQTTLQEHPALVVDIWAEWCGPCRMVAPVVEDLARDFAGR
    VTFGKCNVDENPKIAASFSITAIPTLLFFANGMLVDRVVGALPREAVKARVMRAFGTG

    >gi|126178308|ref|YP_001046273.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Methanoculleus marisnigri JR1]
    MEREYDVVVIGTGNAGSDIAWHCRKAGMQVAIVDSRDYGGTCALWGCVPKKVLAGAAEVVSRAHDQLGNGIRGAIAIDWP
    ELIAFEQTFTDPVPRQKEERFRGAGIHTYHGLARFAGPDRVAVGDDTLTGRYIVIAAGAHPRPLNVPGEDLMTSSDDFFY
    LEALPERIVFVGGGYISFEFAHIAAAAGSAVTILQRSGRALKEFDPDIVDRLLLASGEAGIDVQMNMPLVSVEKNAADLR
    VRAGRDGEEKTFGADMAVHGAGRVSAVGELDPAAGNVETDRRGIVVDEHLRSVSNPAVYVAGDANPGSPQLTPVAVMDAH
    IVVDNILGGNARVADYSVVPSAVFTNPPIASVGLTEEAAKEKGIPYVANAGDLSGRFTNRSIGQKHAGYKLLIDEDSRRI
    LGAHLIGPHVEEVINIFALAIKHGLTVDDLTLDAIPWAYPSSTYDIIHMVYPLVRK

    >gi|126178440|ref|YP_001046405.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanoculleus marisnigri JR1]
    MIVVIGGGPAGRLGAIHLAQAGEEVRLVEQRSIGGQCLHERCMTICALNDVARLVECARTQKDLGILDSVPAVSYPAIRK
    RICEVQEKLSSVLDAETRRAGVEVIYGAVGRLEGSRVFIGDEEVRADAVIAATGSRPAIPEIPGTDLTGVYTYRTLPAMP
    DLPRRMAVIGGGVVAAEFAHIFHAFGVEVEIIARHGLLRDLDEKMRSAALRDLAGIGVREETPVASIEGGGRVRSVLLAD
    GEEIEADAVLLATGLVPRSETLQGLEKGPDGAVIVDRRMRTSVPGVYAAGDVIGPPYLTPAARREGVVAAENILGRDTVM
    DYEGIPQAMSLRYDYAFATTGDGGVTLSSPAPAGPGSFWDVAGGWAGLAQVRVDPATGRLIGAAAAVPGASILLSYIGYL
    MKQGITVDDFDDIVEVHPSTDGVYGLARYAAGMFKKREE

    >gi|126178573|ref|YP_001046538.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanoculleus marisnigri JR1]
    MAEVKNKEARIGVFVCHCGTNIAGTIDVEAVKEYARTIPNVVVADNYAYMCSTPGQNMIADAIKEHNLTGVVVAACTPRL
    HEPTFRNATAAGGLNPFRFEMANIRDQNSWVHMHQPEEATDKAKDAIRIAVAKASLLEDLIPKSVPVEKAAMVVGGGVGG
    MQAALDLANAGIKTYLVEKNPTIGGRMSQLDKTFPTLDCSQ
    CILTPKMVDVYRNENIELLTYTEVESVEGYIGNFDVTLR
    KKARGVLTPAEAEARGIVGGGCTGCGDCATVCPVIKPNPFELGMAPRKAVYIYHPQVSPLIYTVDFDACVKCGLCVEACG
    EKKAIDLEAEDELITVKVGTAILATGYDIFPIEKKFEWGYKNYDNVITSLEFERLICASGPTGGHLIRPSDGDTPKRIAF
    VLCAGSRDNTGVGKPYCSRFCCMYSLKHAHQIIEKIPGAVPYIFYMDIRSFGKMYEEFYYRIQNEGAKFIRGRVANITED
    PVTKNLHVNAEDTLLGRPIDMEVDMVVLAAAIEPAAETEKTRRLFGVSCSQDGWLLEAHPKLNPCGTTTAGVYLAGVCQG
    PKDIPDTVAQAEGAASAASIPIHRGEVELEPYFAVCLEDKCAGCGLCVNQCPYSALSLVEKDGRTVMQVTEAKCKGCGTC
    GGFCPGGAIWMQHFATPQIVAQIDAFLLGGEQ

    >gi|126178740|ref|YP_001046705.1| methylated-DNA--protein-cysteine methyltransferase [Methanoculleus marisnigri JR1]
    MAILTGSCRFGLWHVHVAWQDDLVYRVRFARESIAGSVPEEILRYCAGRPADLASLRSVATEGDSTFAGIYRAVRAIPCG
    ETVTYGEVARIVGTAPRAVGAAMARNPTPIVVP
    CHRVVAKTGMGGFSPDLAIKEILLEMERRGDVCAPEKRGINR

    >gi|126178839|ref|YP_001046804.1| methyltransferase type 11 [Methanoculleus marisnigri JR1]
    METPFIFTLHEGLPRQGPGSNACTRKAFSMLADLSARPEILDIGCGAGMQTVELARICPGCHITAVDIHQPFLDDLARRA
    ASAGVGDRITTVRASMDDLPSPDASFDVLWAEGSIFIVGFEKGLASWRRLLRPGGYLCLTESVWFTEDPSPEAAAFWND
    C
    YPAITTVRETCAIAESAGYAVVATFPLPKSAWWENYYMPVLKRVEDLRPKVAGNPEAEAQIEFAERETAVYREHADEYGY
    EFFILQKKG

    >gi|126178977|ref|YP_001046942.1| methionine sulfoxide reductase B [Methanoculleus marisnigri JR1]
    MNREAVETVETVNVCNAVTGEVEEVEKVVKSDEEWRRQLTPEQFSVARKEGTEPAFTGKYWDCKEDGLYVCVCCGNHLFS
    SKTKFESGTGWPSFSKPVSDLNVRAEPDTRFFMNRTEVLCRRCDAHLGHVFDDGPPPTHQRY
    CMNSASLRFVREKDLGRR
    E

    >gi|126179030|ref|YP_001046995.1| peptide methionine sulfoxide reductase [Methanoculleus marisnigri JR1]
    MAPEKSLERATFGAGCFWGVEEAFRRVPGVVETAVGFMGGTVENPTYPEVCTGRTGHAEVVQVTYDPGTVSYRALLDTFW
    DAHDPTTPNRQGPDIGTQYRSVIFVHTPEQEAEARASKEEMDQSGKFRRPIVTAIEPAGTFWRAEEYHQQYFAKRGGGQC
    RTVW

    >gi|126179262|ref|YP_001047227.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methanoculleus marisnigri JR1]
    MVEVGDQAGDFSIPDHNGNTVRLSAFPGKRVLLSFHPLAWTRICAGQMKALEANREAFEALGAVALGISVDSVPCKHAWA
    ENLGIHKTRLLADFWPHGAVAQIYGVFDSQRGYSRRANIVVDEVGRVIFVAEYPATTVPDMQDVLDALRAQERHTEEVLE
    A

    >gi|126179368|ref|YP_001047333.1| rhodanese domain-containing protein [Methanoculleus marisnigri JR1]
    MEEKMFTPGGMERLQATSDRENIPYPRGDGKVKLVNSEWLDRHLTDTNLTVIDVQPNIHDYIQEHVPGAVYLTEGVLRVS
    NRGFPGSYSPNACIQESFRRAGITADSPVVVYTGKGAFSGAGDGLGQTMMAYTLAKYGHNAVYILDGGIDAWKSEGRELS
    QDYPPVEPSDFTVEVRDDYPIGYEEFVRIKDNDDVVVLDARPAKVYEGKGPWRKAGHIPGAVNLPWKSLMHEANPARLKS
    NDELDMILEEHGVDRSKTVICS
    CGTGREATNEFVLLKWLYLYPNVRIYEGSFTEWVTYPDNPVVEGSDPRGARVETASAR


    >gi|126179505|ref|YP_001047470.1| alkylhydroperoxidase [Methanoculleus marisnigri JR1]
    MKPENEKLIDDFLAHADDLGDEIVTDVEKMLGVVPFIFPILRDRPESFALSTLADYRFSRPDSLDPKTAELIAVAAAAGA
    GADS
    CLKVHIGAALKEGASRDEILDVLLIAAMIGKTRVLASSLRRFREVCGDGREAEE

    >gi|126179602|ref|YP_001047567.1| thioredoxin domain-containing protein [Methanoculleus marisnigri JR1]
    MGKPVLMDFFAEWCGPCHQQTPIIDELKAKMGDQVDIQKIDVGVDSEETRQYAAKYDIQFVPTLVIEKDGQLVQKLVGVQ
    DLGTLESILKPLVEQ

    >gi|126179637|ref|YP_001047602.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanoculleus marisnigri JR1]
    MTEVAVIGAGVAGIQAALDLADHDIHVHLIEREPTIGGHMAQLDKTFPTNDCSMCILSPKMVEVARHPNVTIHTCSEVEG
    IEGEVGNFLIRVRKHPRYILEDECNGCGDCIAICPVEVYNRFDAGIGVRKAIYKPHAQAVPDIVVKDNEHCIECGLCYDV
    CGKEAILREDEERLLEIEAASIVVATGYATFDARNKTQFRYLIIPDVITSLEFERMINASGPTGGKLKRLSNGKPPRSVA
    FVQCVGSRDISVGRPYCSGVCCMYAMKNAMLIREKNPDVEVTVFYNDIRAYGKGYEEYYERARSLGVRFVRGFPGEVLEE
    NDHLTMVAENTETGEVETFHPDLVVLSVGLEPATEADEVARMLGIPRDESGFFGVADQKVGPVLTVKPGIYVAGTATAPR
    DIPDSVAMGGAAAMRAYLDTIRVG

    >gi|126179655|ref|YP_001047620.1| geranylgeranyl reductase [Methanoculleus marisnigri JR1]
    MQNRCDVVVVGAGPAGSTAARYAAKTGLDVLLIDKRRTIGVPVCCGEFNASSEVLASVLPNASGLDELFPVDPGLIRREI
    RGAVAVSPGGREYEFELPGYTVDRDAFDRHLADAAVREGAELLPDTKFLGREGSRVTTTRGEVEARVVVAADGPLSRVCR
    SAGMERSAVLAPAITCRVDGEFGDRLKFFFGNRIAPGGYAWVFPKRGCANAGLGVQKRDVPVPVLLRAFLASQGFSARDV
    QAGFVPVSGPIRETVRENVLAVGDAAGHVVASNGGGIAPAMICGRLAGLAAANHLLRGEPLAAYEWEWRSAIGRELLAAA
    RTKRMADRILGSDFLLERTMRLLGGRGIADVIIHGGLRKAHAPRE

    >gi|126179662|ref|YP_001047627.1| NHL repeat-containing protein [Methanoculleus marisnigri JR1]
    MTPIAAPDFPPGLEWLNIDRPLSVRDLSGRVVLLSFATFTCSNCMRLAPDIRRLEERYPELVVVEVHYPGFESAAVGGNF
    REAVRRAGLEHPVAIDRNRLLWQTFGIRDWPTFVLIDPEGNMVGKTGGEGLYGRLNPKIDRLTTEFGQRGMLEKGRLSPG
    TAPETARETSLYRPGKVAADNAGMRLFISDTGHHRIVVAGGDGKILETIGSGAAGNADGPFDEAAFYLPEGLAFDEEAGI
    LYVADTGNHTIRRVSFTERRVATNAGTGLAAPSFGEGGPGTGTALNAPRDLALLGGHLYIAMAGANQIWRMDLATYEVEP
    YAGSGREGLVDGALDKAAFAGPTGIVTDGEALFVADSGASAIRRIKRGMVETRIGHSPEDFGDLDTIARMARIHRPTGIA
    YRDGSLYIADTGNHKIKQFDPETGWVLTRAGDGDRGYRDGLSGEARLNEPGGLVDFGGLWYIADTGNHIVRVYDPVRHIV
    STLALWK

    >gi|126179816|ref|YP_001047781.1| heavy metal translocating P-type ATPase [Methanoculleus marisnigri JR1]
    MPEEKRKAELKISGMHCASCALNVERALQGRDNVYDARVNFANETATVEYDPAKTTLADLERTVSDAGYEVVRSEATVRI
    GGMV
    CASCARVIEASLADLDGVYEARVNLANENARVVYNPEFVTTAEIRAAVEDAGYQYLGLEEEIPEDVEARMREADLR
    DKFRRFAVGFAVSIPLFFYMLFGMPGAAALPVSINLVMLVVTLPVFLYVSAPIFRAAAAALRNRALTMDVMYAMGIGVAY
    GASLLGTFQIVLTADFNFYETAVMLAAFLTLGRYLEARAKGRTSEAIKKLVGLRPRTATVIRDGREVEVPVEAVAVGDVI
    LVRPGEKVPVDGTVVGGESSVNEAMITGEPIPADKKEGDEVVGGTLNVNGVLRIRAEKIGKDMVLSQIIRLVRDAQGSKP
    PVERIADVAVSYFIPAVLAIATAAFLVWYVGAGASLLFSLTVLISVLVVACPCALGLATPTAVTVGIGRGAELGLLIRNG
    EALEVSEKLTAIVFDKTGTLTRGKPDVTDVVALAVPEDRLLAVAAAVEHNSQHPLAAAVVRRAESAGVTVPASERFTTFG
    GRGVSAVVDGEEVLIGNQPFLEEHGVTVPEGAERRIAALQDEGKTAVLVAAGADLAGILAIADTLKPTTKRAVAELKRMG
    LSVTMITGDNERTANAIAREVGIEDVHAGVLPQEKAQEVRALQSRGEVVAFVGDGINDAPALAQADVGIAIGSGTDVAIE
    SGDIVLIRDDLIDAVAAVELSRKVMSRIKQNLFWAFAYNSALIPLAAGVLYPFFGITFRPELAALAMALSSVTVVSLSLL
    LKTYIPPAKRGTLSEADARGS

    >gi|126179927|ref|YP_001047892.1| glutaredoxin 2 [Methanoculleus marisnigri JR1]
    MAVKVISFYQEGCMGCKEQTPILLEAAADLGIEIEEIDAVKNPEYIQKYNLRVTPTTLVLDGDEIRERMEGLVHSEDLEA
    AIRRHLPEPLPR

    >gi|126179997|ref|YP_001047962.1| rhodanese domain-containing protein [Methanoculleus marisnigri JR1]
    MAVHLHPLLAFLSVVVLVLAGGCFEGSPAPDDRVVRTITPSEASALIEERGDDPGFVIIDVRRPDEFAGGHIPGAVNIDS
    AEFSEHLNSLDAGATYLIY
    CQRAGRSSGVRELMREAGFCEVYEIEGGMNAWNAAGLPVTGS

    >gi|126180001|ref|YP_001047966.1| alkylhydroperoxidase [Methanoculleus marisnigri JR1]
    MDFEKILTRIVERGSDTIAEELLREIESEYGRVPLIFERMAERPEILISHLLYKGAVVETSQLEPKTIELISLAVGAALK
    CNH
    CVEYHMQSAMAKGATRAEILEVILIAGLLANSAVLADAYRVVNGAPCPSCDINGTGLDKTCSDK

    >gi|126180264|ref|YP_001048229.1| hypothetical protein Memar_2324 [Methanoculleus marisnigri JR1]
    MNPARGHDPEAPEAPMQEKSPPNRLINEQSPYLLQHARNPVDWYPWGEEAFSRAREEGKPIFLSIGYSACHWCHVMEEES
    FADQQVAKLLNDVFVCIKVDREERPDIDQVYMAAAHALTGAGGWPLTILMTADKKPFFAASYIPKESRYGMTGLLDLIPR
    ISKVWQTQRQGLENAGDQVLQALQSAARTPPEEGELAEAVLDEAYNMFFRVFDGENGGFGDAPRFPTPHNLIFLLRYGNR
    TGKEPAYTMVEKTLHAMRRGGIFDQVGYGFHRYSTDAEWFVPHFEKMLYDQALLVMAYTEAYLATGREEFARTARETIAY
    VLREMTDPDGGFYSAEDADSEGEEGKFYLWTKDEILGVLGEEDGERFSRIFNVTEPGNYREQPGGKRTGRNILRLRRPLA
    SWAHEFETPEDDLAWSVEEGRQKLLAARKQRVRPGRDDKILTDWNALMIAALAKAARAFDEPDYLAAAERAAAFVLANLR
    REDGRLLHRYRGGEAGLAATLDDYAFMIWALIEVYEASFAPGYLKTAVDLSRDLIARYWDCNEGGFFFVPDDGDVPVRQK
    PVYDGAIPSGNSVAMYALFVLGRMTANLELEETAERIRRVFAGTVSESPTACSHFLTGLEFMLGPNFEVIISGVPDAEDT
    RAMIGAIRSHYAPDAVIIFRPSDEEEPEIVEVAGFTRDIVMIEEKATAYVCTNYACDIPTTDPDEMVRLVKSAGRPSEPI
    V

    >gi|126180265|ref|YP_001048230.1| OsmC family protein [Methanoculleus marisnigri JR1]
    MNGRNGVDMERVDALKTVMQGDPAAGRKTLSAITSWNGGAHSTTIARNFAVPADEPAALGGTDRGASPTELMLAALSACI
    AIGIAYSAAEDGIEVGSIEIDVVGDLDLRGFLNIGDLRPGLAEIRLTVRVDADAPRETIEELVNRGYRRSPVAASLEGRV
    PVRVCIGREETTLSEPRSGA

    >gi|126180266|ref|YP_001048231.1| beta-lactamase domain-containing protein [Methanoculleus marisnigri JR1]
    MLFEKIKSDILAHNSYIVGAGGEAAVIDPRRDCLIYAAVAEREGMKITKIFETHKNEDYVIGSRELARPTGAEILHGARE
    EFGFGTGVHEGETFTVGSLELEILETPGHTIESISLLLRDRSVSGDPLMVFTGDALFAGDVGRTDLAGEDKRREMSEMLY
    ASLHQKILPLPDSTIVCPAHGAGSVCGGNIGDREYTTIGFEKATNGLLSLSKEEFVERKMSERLYEPQYIAMMRKLNREG
    PPLIYNLPHLKAYSPRDIRSLMDRGVQVVDIRSPTSFAGGHIPGTISIWREGLPLYMGYYLNYEDPIVLVDDFNLDLDHA
    VRHFVRLGYDNIAGYLAGGFAAWFKQGEIVERSGTWSPPDLAENLDDPSVWVLDVRNVNHRERDGHIQGSHHIYVGHLEE
    HLEEIPEDKRIVVH
    CDAGYKGSLAASILEKHGFRNVINLLGGTIGWRAANYPLVKEEERTVSASPPL

    >gi|126180393|ref|YP_001048358.1| glutaredoxin [Methanoculleus marisnigri JR1]
    MQRVPGVDRGRVVLYALSTCGWCARTKELLTDLGVGFSYVYVDLLAGEERDHVVREVERWNPQVSFPTVVIDEAKVIVGF
    REEEIREAVGARHSE