Methanocorpusculum labreanum Z uid58785

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|124485068|ref|YP_001029684.1| CoB--CoM heterodisulfide reductase subunit A [Methanocorpusculum labreanum Z]
    MAYTGKKEASTPTAEEPRIGVFICHCGTNIAGSLDVPAVKEYAETIPHVVVAQNYAYMCSTPGQNMIKEAIEQYHLTGIV
    VAACTPRLHEQTFRTATANGGLNQFRFEMANIRDQGSWVHMHDWEGGTEKAKDAVRIAVAKATKLEDLYPMAVPVEHRAL
    VVGAGIGGIQASMDLAAAGIETYLIEKEPTIGGRMSQLDKTFPTLDCSQ
    CILSPKMAEAGRTPNIKLYTLAEVENVEGYI
    GNFDVTIRRHARGVLTPTEAAAKGIVGGGCTGCGDCATVCPVVKPNTWEFGMSPRKAIYIQHAQVVPLIYTIDFDACVKC
    GLCITACGTKKAIDLEMEDELFTIKVGTVIIATGYETFPIEQKREWGYKLYDNVITSLEFERLICASGPTIGHLVRPSDG
    ETPMSVAFVLCAGSRDNTGIGKPYCSRFCCMYSLKHAHQVIEKIPGCKAYIFYMDIRSFGKAYEEFYYRIQHEGAKFIRG
    RVAMIQELPNKNLLVIAEDTLLGMPVEIEVDLVVLAAAIQPTAETEIVRRHFGVSCSIDKWLLEAHPKLNPCGTTTAGVY
    LAGVCQGPKDIPDTVAQAEGAASAASIPIHAGQVELEPYYAQCMQDICAGCGMCTNQCPYSALSMTIVDGRTVMEVTAAK
    CKGCGTCGGFCPGGAIKMQHFTSPQILAQIDAFFLGGEQ

    >gi|124485138|ref|YP_001029754.1| hypothetical protein Mlab_0311 [Methanocorpusculum labreanum Z]
    MGSYISVLLPVLIMTKPVLYDFFATWCGPCRIQSPIVHDLAKKMEGLVDVQMVDVDEHGDLANKYSISVVPTLIIEKDGK
    VIQRLEGVTDAATLESLLKALI

    >gi|124485373|ref|YP_001029989.1| hypothetical protein Mlab_0548 [Methanocorpusculum labreanum Z]
    MVEIDKNFEEAIAEVQTNGAKQTAADWLAKIEEEYGRSPLIYQKLEDNPEALISHLLYKNAVTRAGALPPKTVELISLAV
    GAALRCDH
    CTTYHMQVAKKMGITKEEILEAVLIAGLLANSSVLANAYRLVVPEKEPCAGTCAMQ

    >gi|124485417|ref|YP_001030033.1| hypothetical protein Mlab_0592 [Methanocorpusculum labreanum Z]
    MTMEHNRESAQNDETSVIYFAGGCFWGMEKLMQSIPGVIQTTVGYANGNSSVIPDYKTVSSGKTGYRETVRVEYDSRKVS
    LDALLFSYFRVIDPTLENRQGNDRGTQYQTGIYYVDDSSKETVMRIAEIERERNPVFNVEIGPLTSFYDAEEYHQKYLDK
    NPGGYCHIGAAEFKEATEMIIDPGKYPRPKKETLAEMLDETAFRVTQHADTEPAFQNAFWDRHEKGVYVDVVTGEPLFTS
    SDKYQSSCGWPAFSKSIDDNTIVSREDTSFGMRRTEVKSRSGNSHLGHVFSGDPESPSGMRY
    CINSASLRFIPYADMEKE
    GYGYLKSRV

    >gi|124485468|ref|YP_001030084.1| hypothetical protein Mlab_0644 [Methanocorpusculum labreanum Z]
    MALQVNDFVSPFTLSDASGKTWTFPTDAFRFAVLYFYPKDNSTGCTAEAKDFSALLPEFSRLDTQVFGVSPDSAASHRKF
    TEKQELSVTLLSDPEKTVIGAFGVWVKKKLYGREYMGVERSTFVIDSTGKILAAWDKVKVKGHAEEVLQKIQTLV

    >gi|124485582|ref|YP_001030198.1| ribosomal protein L12E/L44/L45/RPP1/RPP2-like protein [Methanocorpusculum labreanum Z]
    MTNNRDLPAPPTEALPILTLTEANFNTFTLQISALVIDFFNDWCGSCRFFAQIFFDVSLEYPEVQFCTCNTEENSHITAE
    LRIRAVPTLMFIKNGTVVKIRNGALSKEEFREDLNSVFRA

    >gi|124485637|ref|YP_001030253.1| hypothetical protein Mlab_0815 [Methanocorpusculum labreanum Z]
    MTKIEVLGTGCAKCKRLFANTEQAIKELNITVDLVKIETLDQIAERGVMMTPALIINDEIVAEGRVPDVKEIKALLSE

    >gi|124485800|ref|YP_001030416.1| hypothetical protein Mlab_0979 [Methanocorpusculum labreanum Z]
    MNNVVVIGGGVAGIQSAMDIANHNIHVYLIEREPSIGGHMAMLDKTFPTNDCSMCILSPKMAEISRHPNVTILTLAEVEK
    IVGEVGNFTVTVTKYPRYINEKECTGCGDCITICPIEVYNKFDAGIGVRKAIYKPHAQSIPNIVVKDNLHCIECGLCYGV
    CGKDAVLKVTEAKVETLEINASAVVIATGYSLFDPQKKSRFGYLRYPDVITSLEFERMINAGGPTTGNLRRLSNGETPKS
    IVFVQCVGSRDMTINRNICSCVCCMYALKNSMLIKEHYPDCEVSILYSDIRAYGKGYEEYYQRAIDAGVKIIRGLPGDVQ
    DNGKGRLVLPVENTETAEFLNLEADLVVLSVGMIPEPETVRLAKSLGLPLDDHQFLSPADMKLDPAGTIRPGIYIAGAAL
    APKDIPDSVMSAGAAAMKASIDVVRSEQ

    >gi|124485884|ref|YP_001030500.1| hypothetical protein Mlab_1064 [Methanocorpusculum labreanum Z]
    MKIHLETVMKKSFILENLDCAHCAAVMENGIRKIDGVHDASISFMTRRLVLDADDGRFPDILKEAKVICKRVEPDCVIME


    >gi|124485923|ref|YP_001030539.1| hypothetical protein Mlab_1103 [Methanocorpusculum labreanum Z]
    MRQGACSFGLWKVAVDYDDMVVHRVRFMRTAPDGPVPIEFTRFLAGKGTGFAPLTSAALGGDGTYAEIYRAVSRIPYGET
    QSYGEIAKAAETHPRVVGNAMARNPTPLIVP
    CHRVISSDGSLGGFSPDLEIKKSLLQLEKSSLRRHIS

    >gi|124485932|ref|YP_001030548.1| sulfide dehydrogenase (flavoprotein) subunit SudA [Methanocorpusculum labreanum Z]
    MDRDADLRVADFEEVDLGLTKEQVIAEAKRCIQCKKPKCISGCPVGIDIPAFIQAIADEKLQDAVDIIKKDNMLPAVCGR
    VCPQETQCQGVCVLGIKGTPIAIGQLERYVADIERKKGAK
    CPKCAQPTNKKVAVVGSGPAGLACAAELARRGHSVTIFES
    LHEAGGVLMYGIPAFRMPKDIVQYEINQVKKLGVEIKTNHIVGRSVSVEELLSYSAVFLGTGAGLPYFMGIQGENLPGVY
    SANEFLTRVNLMGANKFPENDTPVKVGKKVVVVGGGNVAMDAARVARRMGADVTLMYRRGEADMPARLDEVRHAKEEGVF
    FMTATNPIAILGENNAVSGVKAIKMELGTPGDDGRCSFYPVEGSEFVVEADVVIEAIGQGPNPLLLRMLPELTRNRNGSV
    AVNCLGETSIQKVYAGGDVATGAATVILAMGTAKEAAVAIDKKLRT

    >gi|124486053|ref|YP_001030669.1| hypothetical protein Mlab_1233 [Methanocorpusculum labreanum Z]
    MKKTYSVSGMTCSACSLHVEKAAKSVEGVNSASVNLLENRLVVDSDDVSDDRIRQAVRAAGYDLVLGDTPRGGASLRPMQ
    IRLIVSFAFLIPLMYVSMGHMWGFPLLEWTHDPANAGIFALVQLCLTIPIVIANNKYYTSGIPALFRRAPNMDSLVAMGS
    LAALVYGLYAIYMIFSALATGDTAAAGTWSMDLYFESAAMILSLVTIGKYLEARSKGKTTEAVRKLIDLAPKTATVLRSG
    VEVIVPAEEVVVGDLIVVRPGAGIPVDGTITEGSAPIDMSALTGESIPVVKNSGDAVSAGTISLGSFTFRAEKVGEDTTL
    AAIVELVQNANASKAPIGQLADKVSGIFVPLVMTIAVVSGGVWLLLGEPFTFSLSIAISVLVISCPCALGLATPVAIMVA
    TGKAASLGILIKSAESLETAGRADTILLDKTGTVTIGKPEVTEVVTLSGTTEDLLLIAASVESASEHPLSKAVVTYAGEH
    GIVPVKAQDFVSVPGRGVSASVNGKICYAGNAAFMEENGISFTPANMTGTPLYFASGKEMLGIISVADRIRPTSKAAIAG
    LQNLGLDVILLTGDTKTVAESIAGQLSISNVIAEVMPAEKEGKVRALQEAGHHVIMVGDGINDSPSLARADVGIAIGAGS
    DIALESADYVLMKSDPWDIVSAIRLSRATLRNIKENLFWAFIYNTIGIPLAAGVFFVPFGWKLSPGFAALAMSLSSVCVV
    LNALRLRFFTSEIPTTSKEETMKKVLTIDGMM
    CEHCKMTVEKALSRIPGVVSAVVDLKAKTAAVELSAEVSDAEFTKVIS
    ESGYTILSIK

    >gi|124486173|ref|YP_001030789.1| dihydrolipoamide dehydrogenase [Methanocorpusculum labreanum Z]
    MAALRLAGAGKEVTLLERKAIGGTCIHDGCMLVCGLNDVARSINTISFLKNSGVIDGNASVRFPDVIQKLEGVQRKLETI
    LERETKAAGVVIEYDAAVEIRDGKLFVNGEPRKAENIIIATGAGIHVPDIPGSSLSGTYTAKTLRTMPTLPKKLAIIGGG
    ISAAEFAYIYAAFGCEVTIFCRSVLLPILPEKMMKAALRDLANVTILYGQVEEILGKDKVEGVRMDGKDLPFDAVLFATG
    MKAETSLFTGMKKNPDGSIKVNERMETSIPGIYAAGDVTGAPYFTPVARLQGFAAADSILGHPRTVDLDQIPFTIVLGLD
    YTICAPKKGEEGVTFSSPNIAGPESFWHVADGSVGSMHLTVSKEDGLILGFATAAPSTSIVGTYLGYLVRKGVTVHEFSP
    MLEVHPTPDGMYSMIRLADDALNRQ

    >gi|124486316|ref|YP_001030932.1| hypothetical protein Mlab_1501 [Methanocorpusculum labreanum Z]
    MLHEVVVYSLSGCPHCKALKTFLDNQNITYTNIDVGEDEKAAAEMIKISGQRGVPVTVIDGEKIVIGDDLKKVMEYLDAP
    VAVKKTPDVSADHDLVVIGAGAGGLSAAMYGARKGIDMVVITGAIGGMVNQSYVVENYPGIPDISGADLMKKIYDHTVNS
    GGIFVEDVVTGISKAGDVFSIDTLNGAHYTAKAVIAATGRSPRLSGAKGETDYLGKGVAI
    CTTCDGPLYKNKVVGILGGG
    NTAVDMAIELSDIASKIHLIVRSKLKADKVLIDRLKTKKNIVLHKGYTIEEFGGGQFLEYVILKKQGGITSLLGKGEEKI
    PVDGVFLGIGLDPNTSIFEGLGVTMNPNKEIIVDIDCNTNVPGFYAAGDATSIKAKQIASSVGEGVKALLSAYDYLKR

    >gi|124486533|ref|YP_001031149.1| hypothetical protein Mlab_1721 [Methanocorpusculum labreanum Z]
    MMKKFLLILVSLVLILTISAAGCVDVSQSPSNRTITDMNGAEVVIPAEINTVVNLWPASNSVMLCMGAGDKLIGTTSFTK
    SLYWSQKVYPAIVDVPVGTDNVEELLALSPDLIITPQKATAEKLRAAGLPAI
    CLMFSDYDTMKQAFGILGEALGGDYVEK
    AAKWSDLVDENKARVQAAIGDIPEDEKPVVYYIQGQSNQGLYATFSANSIMEDWTETAGGIFASTRLNLTGNTASAEEVL
    ALNPDVIIIGGPAQHELYDELMASEEWKEINAVKNGRVYTNPNGLFPWERFGMESALQILFAASVIHPDLFQVDMVSEVQ
    DFYKEFVGIDLTKEEAQNMINGYGPNGETYT