Methanococcus vannielii SB uid58767

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150398777|ref|YP_001322544.1| selenophosphate synthetase [Methanococcus vannielii SB]
    MVTLHGCACKLPNTELEQLVNGIILEGDLKHAKVGLGDDSAVIIKNNLAIVKTVDVFTPIVDDPYIQGKIAACNSTSDVY
    AMGVSEIIGALVILGIPPELPINTAKEILRGFQDFCRENDTTIIGGHTILNPWPLIGGAITGVGNPEDILAKAGAEKGDI
    LILTKPLGNQTAMALSRVTEDFNDLIGMTFEEKNNVIKNAIKLMTTSNRNALLVLRELEEEIGEKIANSMTDITGFGILG
    HANEMAEQSNVEIEISTLPVIKGTKDLASLFGHALCKGYGAETSGGLLISVKEEYSKKLIEKLTKNGIYAFNVGKVLKNG
    VGIAKLSENVEILEI

    >gi|150398827|ref|YP_001322594.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus vannielii SB]
    MEEPKIGVYVCHCGVNIGGVVDCENVAKTAEGLKNVVISREYKYMCADPGQELIKKDIKELGLNRVIVAACSPRLHEPTF
    RRCVEEAGLNPFLFEFANIREHCSWVHMKEKEKATEKANDLVRMAVAKARQLDPLDYLTVPVTRRALVIGAGVAGIQAAL
    DLGDSGYETILVEKTPSVGGRMAQLDKVFPTNDCSI
    CILAPKMVDVAKHPNIKLYSYSEVKDVSGYIGNFKVKIEKKPRY
    LSEEKCTGCGSCEEVCPITVPNEFDMGIGMRKAIYKPFPQAVPAKYTIDKESCIDCGLCAKVCGPQAINYNQKPEIIEAE
    IGTIISAIGYDPYDPTEKEEYGYGKIPNVITSMELERMINASGPTMGKVIRPSDGKKPKRIAFIQCVGSRDAKIGKKYCS
    NVCCMYAMKNSQLIKEKSPETEIDIYYMDIRAFSKGYEEFYERSSKQYGIKFIRGRPAQVLDNPKTDNPTIRSEDTLLGE
    IFENDYDLVVLSVGMVPSKSADEVQKLLGVSRTTDRFFMEAHPKLKPVDTATDGVYLAGACQGPKDIPASVAQGSAAASR
    AAIPLAKGEVQVEPIVVTLDEDVCGACGICVQQCPYGAPRFVEKDGKQALEVLSALCKGCGTCAGGCPSGALEQSHFKTN
    QIYGQIEGVFKDSY

    >gi|150398828|ref|YP_001322595.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus vannielii SB]
    MIKINTEDCYLCKACENNCPTEALKLNPLKVCQLCGKCTSVCPNDALHLREIELSGKKIKQIEYKPTKCNLCGECVKVCP
    NNLKIENSKLKGF
    CVGCTKCVDICPDDYVGMEGIIEPAKRNFVIPKEPIVVTDTCVGCGICVPECPVASISLENEKAVVD
    KKSCIYCSICAQTCPWNAIFVAGKKSPKRDKKIIKFDVDDELCIGCGDCTDKCPRNLIVVKDMVAIPPKGCPACGLCVST
    CPVDAVDLKVEYGQAKPATSEGIIWDEEKCVYCGPCAIKCPNKAIAVVNPKGLEIPSKLKTEKQNQFRMCIRCGACVQIC
    PTGALRLGKINHKGKDYDRIEFSPSLCNNCGKCIETCPYDILKLTGKREKPLEGFCVMCLKCIEACEKAKKNALSLN

    >gi|150398907|ref|YP_001322674.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus vannielii SB]
    MAYDLIIIGGGPAGLTAGIYAMRARLNVLCIEKENEGGKIAEAGIVENYPGFKSIKGFELAEQFSKHAEYFELPIMHEEV
    IGIDTKSKPYKLTTKNGIYEANSIIIASGSHYKNVGINEDDYLGKGVCY
    CVMCDAFFFINKEVIVLGRGTSAIMAAYNLK
    DIVKKITIVTDRPNLKAVEKIMEERLVEIPNLEIIYNAKPVKVVGENKAEGVIVLIDGKEHLIPTEGIFVSYGYVPNTEF
    LGDTNIELKKGNFINVDKDCKTNVEGIYACGDVTGGILQVSKAVGEGVTAFNSALTYLQKMH

    >gi|150399237|ref|YP_001323004.1| heavy metal translocating P-type ATPase [Methanococcus vannielii SB]
    METKLKVSGMTCAVCANTIERSVSKMEGISKISVNLLEESVSIIFDDKVLSIADITLKIEKLGYNVLGNFEEVVDDEKKR
    EMDLKEKFNRTIFGSLFSIVLFSLMYISIPYKIYVAFLISLPPLFYVAMPIFKSGYNSFLNKTLNMDVMYSLGMGVSYLS
    AILVTLKLLPMNFMFYDTTIMLATLLTLGRYLEERAKGKTSKAIKKLIKLQVKTAKVIRDEIEVEIPIEEVIVGDLVVIR
    PGEKIPVDGRVFEGFSYVDESMITGEPVPNSKSIGNTVISGTINKNGVLKVTTEKIGKDTLLSQIIQLVKNAQSSKPKIQ
    NLADKVVSYFIPVVFIIAIASASYWYFVDSILLSVTTFISVMVIACPCALGLATPTAITVGIGRGAELGILIKDSKVFDV
    SENLKCMIFDKTGTITKGKPEVDEIVSKMPVNDLLMIAGSMEKDSEHPIGRAIVKRAQELNISFKNPKEFEVISGMGLKG
    TVDEKTVVIGNPSLIELNDIKIDEYYLKNISRLQENAKTVVVLAIDNRVEGLIAISDQIKENARNTIDELRELGIESYMI
    TGDNEKTAKVIGKSVGISEKNIYSDVLPEKKAEIVKKIKESVEGYVEFIGDGINDAPALSTADVGIAVGSGTDIAIESGD
    VVLMKDDLKYVTGFVKLSKRVLKQIKLNLFWAFAYNSILIPVAAGALYSYNIKFQPELAAIAMTLSSLTIIGLSLLLRRY
    NPIK

    >gi|150399244|ref|YP_001323011.1| peroxiredoxin [Methanococcus vannielii SB]
    MAVIGEKFPDVELLTTHGKLKLPEHFIEAGKWFVLFSHPGDFTPVCTTEFVAFQKRYDQFRELNTELIGLSIDQVFSHIK
    WVEWIKEKLDVDIEFPIIADERGDLAVKLGMISPFKGSNTVRAVFVVDATGTIRAIIYYPQEVGRNMDEVVRLVKALQTA
    DKGYATPADWPNNELLKEKVIIPPAKDMKTRAERLEACKRGDISGYDWWFCYTNLKE

    >gi|150399300|ref|YP_001323067.1| UBA/THIF-type NAD/FAD binding protein [Methanococcus vannielii SB]
    MNFERYKRQIIMDNFGINSQEKLYNSKVTVIGVGGLGTVVSQYLVAAGIGNLGLIDYQEVEISNLNRQILHFEKNIGNLK
    VVSAKEKLESLNSEVNIKIYPEKLKESHIKDSDIVIDCLDNFKARYFLNELSIKYDIPLVHGAIEGLRGQVTTLVPKETP
    CIECIFKLDDENKTFPVLGVTPGIIGSIQASEAIKLITGIGKPLKNKLLSIDIENNDYFTFNLKKNENCKACGDLND

    >gi|150399324|ref|YP_001323091.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus vannielii SB]
    MNVVIIGSGAGGLTTASNIKKYSANAKITILTEDKHIAYSPCAIPYVIGGEIEKFENIVMHTPKDYERKGIEVITESKVV
    DVVANQNIVIYEEKGIKKEISYEKLVIATGGTPFIPPIDGVNLKGVFKVRTIEDGQSIKEWTKTTKQAVVAGAGAIGLEM
    AFGLKEIGIDVTVVEMVPQVFPRALDPEMAKIVQEYLEENGIRIILEKPLGKIIGNEKVKAVIIGEEQIDTELVIMSTGV
    RSNIELAKLAGCEIGRWAILTNNLMQTSIENIYAVGDCVEVIDAITGQNTLSPFGTTAVRQGKVAAKSIAGIDAESSPVL
    NSMVSKIGALEIGGTGMTETAAKMNGIDVVIGNAKALTRARYYPGGEPIFIKLVCEKNSRRIIGCQIISKERVAERVDAM
    SIAISKKMTVDELLNQEFSYAPPVSMVIDPLTFAAEDAFEKF

    >gi|150399394|ref|YP_001323161.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus vannielii SB]
    MIAVVGAGPAGLSCASMLSKFGLSVELFERDKLGGTCLNYGCRYINALKDVSDTIESLNSIKGKKHTLNDILSLSDLHNK
    IDNIHEVMRENSLESLTKKGIVVKFKEFKEEYEKDYDYVVYATGYDYPTSFEGVECAKYNEIPYIRKLPKKVLVIGGGTV
    AAEYASIFSTFGSDVTVYVRSKFLKMIEDDEVREYIINNISNFKITSDINVMRKMLNDNEYFNVLAVGGTPKYKTNEFLQ
    VDGKNNVYACGDAVKGGYTPIANREGKLVAENIYNAIKGIPLKKMTYGINISTIRMPMNISVLGKQTLNFKTTYNRPGSG
    YYFKKSEKRGMNRIYYENGKVVGAIAMTPATDVSPYFLQYIKGIDVYNEFLEVYPSNDPFYWQV

    >gi|150399449|ref|YP_001323216.1| redox-active disulfide protein 2 [Methanococcus vannielii SB]
    MIIRVFGMGCKKCTETYENVKKALEELEINAEIKKIMDLNEISEWVLMTPAVSFDDDIIFEGKVPSILEVKKELEMYLKR


    >gi|150399525|ref|YP_001323292.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus vannielii SB]
    MSSSIWYLYEFVRKKWFKKFTNAKSEKESYIEPERFRKIPVTVDFPEKCISCSACAESCPSDAILMKHNEEYNRIMPDFD
    DGSCINCGNCVESCPTEVLEMGTLRKEASGLSWNVPKKINLVIDSEVCVSCSSCEKVCPVDAISHNRFSIYKIDVNSCVS
    CKKCIDSCPVENAILTYDELSLSNKIDVSQYKKFDRERLGMNFKVEMDIIPEIPRIVPELCINCKN
    CVDVCPGLIDIEKL
    TVVTCVKCGHCLSVCPTSAIRTGTLAKITKNTKKCHTINDKKCIGCRICYKSCNVPNALNISKETNLPYIDPIYCVRCGI
    CENVCPVDAVDILKTDVSLDISLKQKVRDEFGNILQKDLEEFTKSYVLLKEEIKEKGKKIISDTKIPEKNKKGD

    >gi|150399526|ref|YP_001323293.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus vannielii SB]
    MVSELVKKYFDDLNVTLELESQLISNKIEINPETCILCNKCVDICPVSAMNSKYPDIPNINKSCVYCGNCVDICPVSAIK
    ITKARVKVVDGDIVVEKNHCKNKKIMYDRKKCVMCIVCIKNCPFGAIDELKSGIKFNEKCVLCGHCERICPADAIELE

    >gi|150399602|ref|YP_001323369.1| transporter component [Methanococcus vannielii SB]
    MDIYQYLPAIGTLVFGTLLGYLGQRSALCFCGGLRDFSLMKDTWLLKGLFGFIGGALIGSILFHIVGLLPLFPWILTKGV
    TAIPGGAAGGLGFMPNLVAALIGGFGVGFLSIIQGG
    CPFRNFIMAGEGNQTAIMYIIGLAVGAVIYHQWALSFIQSILA

    >gi|150399682|ref|YP_001323449.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus vannielii SB]
    MIVTNIKNCRSYENCEKCPNTDISKCMEACPTGAIKLLDGKAFSCITCGTCEKECPTGAIKKNEYGGYYVNRKKCTGCGI
    CKNVCPINIIEIKETENKKSYPDGICVMCGLCTTACPYDARIYFDPSKLKNSKNKMLMERYSAIFKLMGKTYEFKVPKTD
    VTIKNPAERTIRKSININHNECNECGKCIYLCPKNTIIEGKMVDACTRCNLCSDACPVNAIEFGKVNENCVLCGNCILKC
    PKDVLKIENFKISKTKEEMAIKPVKHCINCGLCVDKCPTGALRFNAGKILYDPNTCIL
    CNLCVKECPKKVRINKGDHIDG
    ACVLCEICINNCPNNAIVVKEVSKFTKIDKKECIACGTCSKVCPNNAIVVKINSLNMNGNPVHSEVIFNENCVMCENCAI
    HCPRDVIENTTGYKKIVDIENSYIRADFDYCVKCGLCNIICPNDAVDKGEVDTKKCEYCSACVNICPTHALHIYRTWNEK
    ID

    >gi|150399689|ref|YP_001323456.1| redox-active disulfide protein 1 [Methanococcus vannielii SB]
    MVKVEVFTSPMCPHCPAAKRVVEEVAKEVSGVEIVLVNVMDNPEKAAELGIMAVPTIAINGEIKFVGAPSKDALRVELTK


    >gi|150399742|ref|YP_001323509.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus vannielii SB]
    MAGIFIQEDACLVCNACAKACPTEAIEIAPFKTCIQCFSCANACPTGALTERDGKLVFNGTKCDKDGACQKACPTGIKKV
    DGRFPYSKGH
    CVLCEKCVDICPVEIISLPGKIDKPKKDVIIPNEPIAVTKDCVACGVCVPECPVDAISIEDTAVIDTNKC
    IYCTICSQTCPWNAIFVAGKKPQKRQKNIKSFTVNSEECIGCEKCVEVCPGSMIEYDANNLSIKLPVACPACSLCVESCP
    VDVIKLEVEYAPSKPVTEDGLMWLEEKCTYCGPCAVKCPTGAINVVNPKGLELPSKKKTDKANEYRMCIRCGACAIKCPT
    SALKMGKIAHEGKEYTRVEFNPSLCNECGDCINICPQKTLELTGEANMPLKGYCVMCLKCIEACNKAKKEALILK

    >gi|150399747|ref|YP_001323514.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus vannielii SB]
    MSDPKVGVFVCYCGANINGAVDCEVVKDFASKLDGVVVSASYPFMCADPGQGLIRDAIKEHGLDRIVVAACTPKIHEPTF
    RGCLHDAGLSPYYLEFVNIREHDAFVHMNDVKIATKKACELVAGGVERAKKLEDVPQKIVEVDKSCMVIGAGIAGIQSAL
    DLGDQGFKVYLVDKDESIGGRMAQLAKTFPTDDCAM
    CILAPKMVSVANHPNVELITFAEIKNVDGYIGNFEVTIEKKPRS
    VDEKTCTGCGACASACPIEVPNEFDLGLGTRKAIYVPFPQAVPLLYTIDKEHCIDCGLCAKVCCADAVRYGQKPEELKIK
    VGTIITATGYDEFDARRKEEYGYGVYENVITTLEIERMINPAGPTHGHEIRPSDGKHPHRTVFIQCVGSRDEKVGNPYCS
    RVCCMFALKNAQLMKMHDPSAEVYVCYMDIRAFGKGYEEYYKRAQDQFGVKFIRGRPANIIEDPETKNLTVRVEDTLMGE
    ILEIDADLVVLSAGLEPKKDAAELGKMLGIDRGPEGFFKELHPKLAPVNTKVDGIAIAGVAQGPKDIPDTVAQAKGAASA
    VAIPMSQGQFKIEMIRATVNEEVCGGCKVCALMCPYNAITYEEKEGHLVAISDDVACKGCGSCAAVCPSGAMQLRYYRDE
    QIIGAIDGILDAVKMLEK

    >gi|150399827|ref|YP_001323594.1| methylated-DNA--protein-cysteine methyltransferase [Methanococcus vannielii SB]
    MEYTSPTFNDKCYELLKNVPKGSVTTYKIIARALNTNAYRAVGNAMKRNQNLLNVPCHRVVNSNGSVGEYILGTEKKIEI
    LKSEGIEITNGKIVDFNNRLFKF

    >gi|150399974|ref|YP_001323741.1| heavy metal translocating P-type ATPase [Methanococcus vannielii SB]
    MYRHYELKGLCCANCALKIERILCENGYPSARINFSTSELLFAEKSVDINFVKKLIHSIEPEIILIEKENLDYKLSSNLT
    FKDFVDFKELKIIIFSLILFIFGIFGSYLNFEPFIVLMIFLTSYMISGNKVFKKTFKNVKRGDFFDENFLMTIATVGAFL
    IHEYPEGVAVMLFYRIGEFLQDLAVSKSRSSVKSLLSLKAEYANLKKDDKLLKVSPETVKKGQIIIINPGEKTPLDGIIL
    NGNSSIDVSALTGESSPRYLKDGDEILSGMVNLTGPLTVKVTKEFEESTVYKILELIETANVKKAKTEKFVTKFARYYTP
    FIVFLAFLVVAIPILAFNEPIIPWVYKALVLLVISCPCALVLSIPLSYFAGIGKLSKDGILVKGSNYIDMLSKTNYVIFD
    KTGTLTKGSLKVKEVFPKNGFSKEELIEIAITSESRSNHPVAKAIISKYGTNRFFEFSEYKEIPGKGIVAKIHGFEVISG
    NEKLMEESGIDVKPMDSFDIAVHFAIDKKYAGYILVSDELKKDSKNAILELKKLGIKKISMFTGDSYPVSKKISEEISID
    EFYSDLLPKDKVTLLEEIERKKDKNESIVFVGEGINDAPAIKRADVGISMGTLGSDAAIESSDVVIMDDNPLKVAQSIKL
    SKRTKNIVWQNIFMIFGVKIAFITLSIFGRVTMWEAVFADVGITIISVLNSLRILK

    >gi|150400057|ref|YP_001323824.1| hypothetical protein Mevan_1315 [Methanococcus vannielii SB]
    MVKNRLINEKSPYLKQHAKNPVDWYPWGEEAFKKAKLENKPIFLSIGYSTCHWCHVMAKDSFEDFDVADTLNKNFISIKV
    DREERPDLDDIYLKTCQLMTGSGGWPLTIIMTPDKKPFFAATFISKEPRFGSPGIIDLLEGISELWAIKHDEIVKRSDEI
    LIHLENISKTTSKGKLDEKLLEKAFLQLKEIYDKNYGGFGVPKFPTAHLIIFLIKYWKKTGNDEALEMAIKTLDKMKMGG
    IYDHISYGFHRYAVDEMWKLPHFEKMLYDQALISMAYLESYRATRNEEHKKIVSEVFEYVLKVLKSPEKAFYSAENAESE
    GIEGKFYTWNITEIDQILRNSENNIFKKVYNIKPEGNYLGESTEATNGTNILYMERSIQEIASEMEMWPEEVDQILEKAR
    KKLLDALENRKRPSKDYKILADWNGLMIASLSKAGRIFKNEEYIKASEDAMSFLLSKMVINEKLYHSYIENELKVPGFLD
    DYAFITWGLIELYFATFNIEYLKKARDFAEKTLELFWEDGGFNFASKEVNDNIFKVRNIYDGAIPSGTSIMALNLLKLSH
    ILRIDKYHEKVYELFENSAEKISKSPFTYLQMLSAYNFDNDPTDVSIVGDLENKTTKEIIDEINRVYRPNMSLLFIPSDS
    ERLKKLEKIASFVKEYPTSKDPVVYICKKDSCLNPETNPSQILNLLR

    >gi|150400062|ref|YP_001323829.1| DsrE family protein [Methanococcus vannielii SB]
    MKFTIVIKDAPYGKERAFSALRFALTALLEGTDVNIFLLEDGIFVAKRGQNPLNVPNYLELLENVIEAGAVVKACGPCGK
    ARGILEEDLVSGVKFGTMNDLTAFVRESDRNITF

    >gi|150400349|ref|YP_001324116.1| methionine-R-sulfoxide reductase [Methanococcus vannielii SB]
    MKKVNKSEKEWEEILTPEQFLVTRKKGTEPPFSGKYYNNKEKGTYLCSNCKSELFSPNTKYDSSSGWPSFYAPILKESII
    CIQDNSCNIKRTEVVCAVCNAHLGHVFDDGPKPTGKRY
    CINSISLEFLKL

    >gi|150400421|ref|YP_001324188.1| redox-active disulfide protein 2 [Methanococcus vannielii SB]
    MDIKIFGTGCKKCTEVYKNVKKAVDELKINAEIVKVTDIAEISEYVMITPGIAVNEGVIFEGKVPGVEEIKEELSKLY