Methanococcus maripaludis S2 uid58035

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|45357632|ref|NP_987189.1| methylated-DNA--protein-cysteine methyltransferase [Methanococcus maripaludis S2]
    MKTFNEQCYDLIMQIPRGKVTTYKIIAEALNTKAYRAVGNAMKNNPKILTVPCHRVVNSNGYVGGYVNGVEKKIEILKNE
    GVVISGGKITDLKKYLFVF

    >gi|45357766|ref|NP_987323.1| hypothetical protein MMP0203 [Methanococcus maripaludis S2]
    MKITILGMGCKKCVEVYDNVKKAIEELKIDAEVVKIADAAKIAEYVMSTPGVVVDDEVIFEGKVPSVEEIKNELSKL

    >gi|45357771|ref|NP_987328.1| hypothetical protein MMP0208 [Methanococcus maripaludis S2]
    MQYREIKKTGDKISALGFGAMRLPTKNGSIDKERAKKQIYYAIDNGVNFIDTAFPYHGGASESFLGEILSENYRNKIKLS
    TKLPQWQVKKYEDMEMYLDIQLKKLKTDFIDYYFIHSLSKDSWAKMKDLGVLKFLDEAKKSGKIKYACFSYHDNTETFKE
    IIDAYDWDACLIQYNYLDEQNQAGTQGLEYAASKGIGVFIMEPLRGGNLSKKVPKEAEEIFNSYKVKRTPADWALRWVLN
    HLEVT
    CVLSGMNEEAHVKENLKVASETTPDSLSNEELEIYDKVKEVYRKLMKINCTGCGYCMPCPFGVDIPACFSMYNEK
    SIFNDKKTGFLYLARLGGVMGGEESHAGLCVNCGKCVKACPQNLDIPVLLKDVSTELGGSGFNLKIKLAKIAMSIYSSFN
    SLKQKISKN

    >gi|45357779|ref|NP_987336.1| cation transport ATPase [Methanococcus maripaludis S2]
    MQKYILKGLCCAGCASKIEKLLKEQGYPSAVINMATSELILDEKEIDLEKITKIVTSIEPGVIVIPKQSEIKITNEIDYN
    ELKKIVISSVFFILGIFSSHFGYSLSIQLLFFIVSYILVGQKVLKKTFQNIKRLDFFDENFLMSIATIGAFLIGEYPEGV
    AVMLFYSIGEFFQNIAVTRSRNSIKSLVSIKAEYANVLENGETIKVKPENVQIGQTIIIKPGEKVPIDGIVLNGKSSLDT
    SALTGESTPKSINRDEEVLSGMINLSGLLTVQTTKNFSDSAVSKILNLVESASINKTKTEKFITKFAKVYTPIIVFIAVL
    LAVVPPIIFNEPFVPWFYKALILLVISCPCALVLSIPLGYFAGIGRLAKEGILVKGSNYIDVLSKTTYVSFDKTGTLTEG
    KFKVTKVVSKNEFSGKKLLEIAKMVECNSNHPIAKTIMDFGTISCKTSLDDFEEFSEVLGKGIISRINGSEIIAGNEKLM
    EEKNINFEKLDVYETAVHFAVDGVYAGYILISDKLKKDSKETVLELKKLGIKKVSMLTGDKKDIAEKIASELNLDEYYSD
    LLPEDKVKIIEEIEANKSKKETIAFVGEGINDAPVIARADVGISMGTLGSDAAIETADVVIMNDKPSKLISAIKISKRTQ
    NIAFQNIFVILIVKIAFISLGIFGETTMWQAVFADVGVALLSVLNAVRILK

    >gi|45357872|ref|NP_987429.1| DsrE family protein [Methanococcus maripaludis S2]
    MKFTVIIGDAPYGKERAYSALRFALTALLEGIDVNIFLLEDGVYVGKKDQNPAGVPKYSELLENAIEAGAVVKACGPCGK
    ARGISEEELLDGIAFGTMHDLIAFVKEADKTINF

    >gi|45358124|ref|NP_987681.1| carboxymuconolactone decarboxylase [Methanococcus maripaludis S2]
    MNEKSSISDEKLCGLMEIVEKRYGKVPYIIEKMKNNPKLLESKINYDEAVVDEYKHIDPKTAELISIAVVSALGCEHCIE
    FHIEAAKKMGISEEQIMTAVLIAGSLSNAAVLSKSTRALQKVNNILKYDENSLSCPECNISGIK

    >gi|45358387|ref|NP_987944.1| coenzyme F420-non-reducing hydrogenase subunit beta [Methanococcus maripaludis S2]
    MIKINTEDCYMCKACENSCPTEALKLNPFKVCQLCGNCVNVCPNDALNLREIELNGKTIKQIAYFPTKCDLCGECVKVCP
    NNLKIENDKLKGFCVGCMKCVDACPDSYVGMEGVVEPAKRNITLPKEPIAVTEDCVGCGVCISECPVGALSIEGEKAVVD
    KDSCIYCSICAQTCPWNAIFVAGKKSPKRDKNIVKFSVDSDLCIGCGDCTDKCPRDLIVLNEMVAVPPKGCPACGLCKAA
    CPVDAIELVVEYASPKPITDEGIVWDEEKCAYCGPCAIKCPNNAITVVNPKGLEMPSRKKTEKANEFKMCIRCGACVQSC
    PNDALRIGKIIHNGKEYERIEFSPNLCDSCGKCIETCPYDMLKLTGKSEKPLEGFCVMCLKCIEACDKAKKSALSLK

    >gi|45358388|ref|NP_987945.1| heterodisulfide reductase subunit A [Methanococcus maripaludis S2]
    MEEPKIGVYVCHCGVNIGGVVDCENVARTAEGLENVVIARDYKYMCADPGQELIKKDIKELGLNRVIVAACSPRLHEPTF
    RRCVEEAGLNPFLFEFANIREHCSWVHMKEKEKATEKANDLVRMAVAKARQLEPLDYLNVPVTKRAMVIGAGVAGIQAAL
    DLGDAGYETIVVEKTPSVGGRMAQLDKVFPTNDCSI
    CILAPKMVDVAKHPNIKLYSYSEVKDVKGYIGNFKVKIEKKPRY
    LSEEKCTGCGSCEEVCPISVPNEFDMGIGLRKAIYKPFPQAVPAKYTIDKESCIDCGLCAKVCGPQAIDYGQKPEIIEAE
    VGTIISAIGYDPYDPTEKEEYGYGKIPNVITSMELERMINASGPTMGKVIRPSDGQKPKRIAFIQCVGSRDAKIGKKYCS
    NVCCMYAMKNSQLIKEKAPETDIDIYYMDIRAFGKGYEEFYERSSKQYGIKFIRGRPAQVLDNPDGDNPIIRSEDTLLGE
    IFENEYDLVVLSVGMVPTSTADEVQKLLGVSRSADRFFMEAHPKLKPVDTATDGIYLAGACQGPKDIPSSVAQGSAAASR
    AAIPLAKGEVQVEPIVVTIDENVCGACGICVQQCPYGAPRFVEKDGKVVAEVLSALCKGCGTCAAGCPSGALEQSHFKTS
    QIYGQIEGAFKDSY

    >gi|45358411|ref|NP_987968.1| peptide methionine sulfoxide reductase [Methanococcus maripaludis S2]
    MKNIKTTVFGMGCFWGAEEVFRKINGVVSTEVGFMGGTIKNPTYGQVCRGKSGHIEVVKIDYDPEIISYDELLDLFWNNH
    NPTTPNKQGWDVGEQYSSYIFYFDDEQKLIAEKSLEKMQENTDLKIVTIIEKAGSFYPAEEYHQKYFMKKNNSILNF

    >gi|45358521|ref|NP_988078.1| hypothetical protein MMP0958 [Methanococcus maripaludis S2]
    MKHFLNFLVVILLIVSAGCISTEKTDLDMNGQTLMIEFYSTTCPACEELSPHIDELEDEGYNISRINVNENGQMAMNYGI
    NLVPTVVFIKDGEEVDRVIGNQPELIKSKAEEYFK

    >gi|45358522|ref|NP_988079.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis S2]
    MVYDLIIIGGGPAGLTAGIYAMRAKLSTLCLEKQNEGGKIAEAGIVENYPGFESIKGFELAQKFSEHAKHFELPIIHEEV
    EKIDTSSKPYKVITKHETYEAKSIVIASGSRYKKPGLNEDDFMGKGVCY
    CVMCDAFFFLNKEVIVLGRGTSAIMAAYNLK
    DIAKKITIVTDRSELKAVEKIMEDRMNLMNNLEIVLNAEPIEIVGKEKAEGVKVSIDGKEKIISADGIFISFGYVPNTEF
    LDGSEIKLNKRKFIETDENCKTSVEGIYACGDVTGGILQVSKAVGEGVTAFTGALSSIQK

    >gi|45358728|ref|NP_988285.1| heavy metal translocating P-type ATPase [Methanococcus maripaludis S2]
    MEVKLKISGMTCAVCVKTIEKSVSKMDGVESIVVNLLDESAVINFDEKFVSIEDIGIKIERLGYEVLGIAEEIEELPDKE
    DELKEKLKKIIVGAVFSIALFSMMYIEIPYKPYLAFLVSLPPLLYIALPIFKAGFNSFRVKSLNMDVMYSLGMGVAYISA
    LLVTLGLLPMNFMFYDTTIMLATLLTLGRYLEERAKGRTSEAIKKLMGLQVKTAKVIRNNEELEIPIENVIVGDILLIRP
    GEKIAVDGTVFEGDSYVDESMITGEPIPNPKKKGDSVIGGTINKNGILKITAEKIGKDTVLSQIIQLVKNAQISKPDIQN
    LADKAVSYFIPVVFTIALISSLYWFFNGGILLAVTTFISVMVIACPCALGLATPTAITVGVGRGAELGILIKDSKVFDVA
    GNLKCMIFDKTGTITKGEPEVDEIISDYSKEEVLLIAGTLEKNSEHPLALAILKKAEELNISLSEPEKFESITGMGIIGT
    LKDLRVLIGNRRLMEENNISINEEYNKEISRLEENAKTVIIVGVENKILGIIAISDKIKENAKITVQNLREIGIESYMVT
    GDNEKTAKVIGKEVGILENHVFSNVLPEKKAEIVKSIKENAGGYVEFIGDGINDAPALSTADVGIAVGSGTDIAIESGEV
    VLMNDDLKYVTGFVKLSKRVLKQIKLNLFWAFAYNSILIPVAAGALYSYNIRFEPELAAFAMTLSSITIIGLSLLLKRYD
    PWK

    >gi|45358737|ref|NP_988294.1| peroxiredoxin [Methanococcus maripaludis S2]
    MVVIGEKFPEVEVTTTHGKLKLPEHYIESGKWFVLFSHPGDFTPVCTTEFVAFQKRYDQFRELNTELIGLSIDQVFSHIK
    WVEWIKEKLDVDIEFPIIADDRGELAVKLGMISPYKGNNTVRAVFVVDATGTIRAIIYYPQEVGRNMDEIVRLVKALQTA
    DKGYATPANWPNNDFLNEKVIVPPANNMDARKKRLEACKSGELEGYDWWFCYTDLKE

    >gi|45358808|ref|NP_988365.1| tungsten containing formylmethanofuran dehydrogenase subunit F [Methanococcus maripaludis S2]
    MKNFKKDENDGVIEISRSGVEKRVLKWDDCTCVGCGICSEICPTSAIEMGPLGAIFKGDIDAPKLDISEKCVLCGMCACA
    CPFDAVKLSINDKPITEMPQYPKIKRGIELNQSKCVLCEQCELVCPQCAIDVEREVPERKSLVLGEITIKKDDCVLCGIC
    AEYCPADAIELIPNDMNALSLNPIADIKIDLDACVYCKVCEKACPHNAIEAICYK
    CPLASKIKKPELYGEIKGQTNIDKE
    LCVSCGWCANICPADAIEVEKPFEGELIIDEPACNACGACISVCPCNALVFPQPEKQGDKVPNVVVNQDVCILCGACTHS
    CPVDALTVKRTKINMTEANAPAWKKAFSKLMK

    >gi|45358822|ref|NP_988379.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis S2]
    MDVVIIGSGAGGLTTASNIKKHDKNAKVTVITSDKYIAYSPCAIPYVIGEEIADFDTIIMHTPKDYKAKGIDVIVEAEVL
    DVVSGENKVIYKKDGTETELKYDNLVLATGGTPFVPPIEGVTLDGVFKVRTIEDGQKITEWAKDTKNVVVAGAGAIGIEI
    AFGLKEIGLDVTVVEMVPQVFPRALDPDMAETVQKYLEEQGIKIILEKPVGKIIGNDKVEAVLVGEETIPAEMVIMSTGV
    RSNIELAKSAGCDIGRWAVLTNEKMQTSIPNIYAVGDCVEVIDAITMQNTLSPFGTTAVRQGKVAAKAIVKLEAEIKPVL
    NSMVSKIGKLEIGGTGMTETAAKMNGIEIVLGYSKALTRARYYPGGKPIYIKMVADKMTKKVIGCQIISEERVAERVDAM
    SVAISNGMTVEELANQEFCYAPPVSMVIDPIVFAAEDTLDKF

    >gi|45358895|ref|NP_988452.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis S2]
    MIAVVGGGPAGLSCAHALAKRGLDVEIYEMDKLGGTCLNYGCRYVNALKEVADIIDNLNAITGKKHDLEDVISLDELHEK
    VYKIHKSMRENAKKTLEKKGIFVKFEEFKEDYEKNYDYVVYATGQNYAKNYLGVECATHRELPYLKKLPKKILIIGGGTV
    AAEYASIFSIFGSEVTVYARSKFLKKIKDDEVRDYIINDLSNFKITHDEEEMKKMLYNDEYFNILAIGGKKRYETNEYFQ
    VLGKSKVYACGDSVRGGYTPIANREGRIVAENIFNEINNHPLKKMDYGVEVATIRMPINISVVGKQTNDFKTSYNRPGTG
    YYFKKAEKRGMNRIYYENGKAVGAVVMTNATELAPYFAQYLKGIEVYKDFVEVYPTTDPFYWQF

    >gi|45358951|ref|NP_988508.1| redox-active disulfide protein 2 [Methanococcus maripaludis S2]
    MKIRVFGLGCSKCNETYENVKKAVLEMNIDAEIEKVTDIKEISEWVLMAPAVAFDEDIIFEGTTPSVNDLKKELKDYLNS
    N

    >gi|45359101|ref|NP_988658.1| transporter component [Methanococcus maripaludis S2]
    MSYVPAIATLAFGILLGYLGQRSSMCFCGGIRDYYLMKDTWLVKGLLGFVGGAILGAVIFNVIGMLPLFPWIATKGLTAI
    PGDAAGSLGFGAHFIVTIIGGFGVGFLSIIQGG
    CPFRNYVMAGEGNQTAMAYVLGLAVGAVVFHMWVAPFVLSILA

    >gi|45359187|ref|NP_988744.1| polyferredoxin [Methanococcus maripaludis S2]
    MIVTDIKKCRTYEECEDCKNKEISKCMEVCPTNAIKMIDGKAFSCITCGTCAKECPTGAIKKNEYGGYYVNRKLCTGCGI
    CKNVCPIDIIDIREDSTGKSYPTGMCVM
    CGLCTTECPYNARLYFDPSSLKNTKNKMLMERYSTIFKMMGKTYEFPEPKHV
    KIVKPAERKLRHSISIDSKKCVECGKCIYLCPKDTIIEAEMVDGCTRCNICNEVCPVDAIEYGQVTEN
    CILCGNCISKCP
    KDVLEISEFKVVKTKEDVKAKPEKHCINCGLCVDKCPSNALRFENGKILYDPKTCTLCNTCVKECPQGVRINKGEFVDGG
    CVLCELCIKECPEDAISIKERSKFTSIDKEECIACGTCSMVCPNDAITVVIDSLNFSGNKVHSKVIFNDNCVICEKCAIH
    CPRDVIENTSGHKKVVDRENSYIRTDNDYCVKCGLCTIICPNDAIDKGEINTEKCEYCSACVNICPTRAIRIYRTWNEKT
    K

    >gi|45359197|ref|NP_988754.1| DsrE family protein [Methanococcus maripaludis S2]
    MVVYNNDISANYGVIMIKEINVKSLRSPAMLVEKVVEKTKGGILLIETDGDSQIPEISELIKKMGYKMEVDGTNVKVSIG
    EIEATKSINVVGASCPGPILMVGEVLERMAVGEILEIVAGANAFTDLTEGLKSMGNDILSAEKTDDGNYKILIKKEEKKK
    ELGVSVDIDEVFIINMTGTGNAEKAYATFMMTEVAQNMKLKPTIFLMFDGASLALKGECDKVKHPAFPKLGDKLRAAIKS
    GVKIYV
    CEMSSEFRGVDKKLEDGIEIAGAPTFFRFLSKPNARPVWL

    >gi|45359198|ref|NP_988755.1| redox-active disulfide protein 1 [Methanococcus maripaludis S2]
    MVKIEVFTSPMCPHCPAAKRIVDEVAKEIEGIEVVHINVMEHPEKAAELGIMAVPTVAINGEVKFVGAPTKDALIAELKK


    >gi|45359260|ref|NP_988817.1| heterodisulfide reductase subunit A [Methanococcus maripaludis S2]
    MSDPKVGVFVCYCGANINGAVDCEAVKDFASELDGVAVAATYPFMCADPGQGLIKDAIKEHGLDRIVVAACTPKIHEPTF
    RGCLQDAGISPYYLEFVNIREHDAFVHMGDVEGATRKACEMIAGGVERAKKLEDVPQKVVDVDKSCMVIGAGIAGIQSAL
    DLGDQGFKVYLVDKDESIGGRMAQLAKTFPTDDCAM
    CILAPKMVSAANHPNIELITFAEIKNIDGYIGNFDVTLEKKPRY
    VDEDTCTGCGACAAACPIEVPNEFDLGLGTRKAIYVPFPQAVPLLYTIDKEHCIDCGLCAKVCCAEAVRYDQKPQELNIK
    VGTIITATGYDEFDATKKEEYGYGVYDNVITTLEVERMINPAGPTHGHEIRPSDGKAPKRTVYIQCVGSRDEKVGNPYCS
    RVCCMFALKNAQLMKMHDPNAEVYICYMDIRAFGKGYEEYYKRAQDQFGVKFIRGRPANIFEDPETKNLTVRVEDTLMGE
    ILEIDADLVVLSAGLEAKKDAGELAKMLGIDRGPEGFFKELHPKLAPVNTKVDGIAIAGVAQGPKDIPDTVAQAKGAASA
    VAIPMSQGQFKIEMIRATVNEEVCGGCKVCALMCPYNAITYEEKDGHLVAITDDVACKGCGACAAACPSGAMQLRYYRDE
    QVIGMIDGILNAAKMLEE