Methanococcus maripaludis C7 uid58847

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150402019|ref|YP_001329313.1| peptide methionine sulfoxide reductase [Methanococcus maripaludis C7]
    MANTETAVFGMGCFWSAEELFRHVDGVISTEVGYMGGNVKNPTYGQVCRGKSGHIEVVKVSYDSKIITYDDLLELFWKNH
    DPTTPNRQGWDVGEQYSSHIFYFTDEQRIVAEKSLEKMQCYMDLKIVTAIKKASDFFPAEEYHQKYFMKKNNCILNF

    >gi|150402078|ref|YP_001329372.1| selenophosphate synthetase [Methanococcus maripaludis C7]
    MKCLKIYLKGGKIEEEIKLTQMVTLHGCACKLPDTELENLVKGIISEDDLKNTKVGLGDDAAVVIKNGMAIVKTIDVFTP
    IVDDPYLQGRIAACNSTSDVYAMGISEVIGGLVFLGIPPELPVSVAKKMLQGFQDFCRENDTTIIGGHTILNPWPLIGGA
    ITGVGKEEDILTKAGCKKGDVLILTKPLGNQSAMALSRVTEEFEDLIDIPKEEQKYIFEKTIELMTTSNRIALLHLRELE
    NELGEKIANAMTDVTGFGILGHSQEMAEQSNVEIEISCLPVIKGTPELASLFGHGLCCGKGAETAGGLLISTKPEYKYKL
    IQKFEENNVYAFEVGKIINNGVGISKLSENVKILEI

    >gi|150402131|ref|YP_001329425.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C7]
    MVYDLIIIGGGPAGLTAGIYAMRAKISTLCLEKENEGGKIAEAGIVENYPGFESIKGFELAQKFSEHAKHFELPIIHEEV
    EKIDTSSKPYKVITKNEKYEAKSIIIASGSRYKKPGLNEDDYMGKGVCY
    CVMCDAFFFLNKEIIVLGRGTSAIMAAYNLK
    DIAKKITIVTDRPELRAVEKIMEERMNLMTNLEVVLNAKPIKIVGTEKAEGVKVSINGTEKTIFAEGIFMSFGYVPNTEF
    LEKSDIKLNKRKFIETDENCKTSVDGIYACGDVTGGILQVSKAVGEGVTAFTGALSSIQKE

    >gi|150402339|ref|YP_001329633.1| heavy metal translocating P-type ATPase [Methanococcus maripaludis C7]
    MEVKLKISGMTCAVCVKTIEKSVSKMDGVDKIVVNLLDESAVINFNPDIVSIEDIWIKIERFGYEVLGIAEEVEELPKKE
    EELKEKLGKIIFGTVFSIALFSIMYLKIPYKPYLAFLISIPPLIYIALPIFKAGFNSLKIKSLNMDVMYSLGMGVAYISA
    LLVTLGILPMNFMFYDTTIMLATLLTLGRYLEERAKGRTSEAIKKLMGLQVKTAKVIKNNEEFEIPIEDVIVGDIILIRP
    GEKITVDGTVFEGVSYVDESMITGEPIPIAKKKGDSVIGGTINKNGILKITAEKIGKDTILSQIILLVKNAQLSKPDIQN
    LADKAVSYFIPTVFTIALISSVFWFFNGGILLAVTTFISVMVIACPCALGLATPTAITVGVGRGAELGILIKDSKVFDVA
    GNLKCMIFDKTGTITKGKPDVDEIISDYSKEELLLIAGSLEKNSEHPLALAIVKKANELNISLSEPEKFESITGMGVSGI
    LKDQKVFIGNRRLMEENNLSINEHYIVEISRLEENAKTVIIVAIENKIMGIIAISDKIKENAKITVQNLREMGIESYMIT
    GDNEKTAKVIGKEVGILENHVYSNVLPEKKAEIVKWIKENAGGYVEFIGDGINDAPALSTADVGIAVGSGTDIAIESGEV
    VLMNDDLSYVTGFVKLSKRVLKQIKLNLFWAFAYNSILIPVAAGALYSYNIKFEPELAAFAMTLSSLTIIGLSLLLKRYD
    PWK

    >gi|150402347|ref|YP_001329641.1| peroxiredoxin [Methanococcus maripaludis C7]
    MAVIGEKFPEVEVITTHGKLKLPEHFIESGKWFVLFSHPGDFTPVCTTEFVAFQKRYDQFRELNTELIGLSIDQVFGHIK
    WVEWIKEKLDVDIEFPIIADDRGALAELLGMISPYKGNNTVRAVFVVDATGTIRAIIYYPQEVGRNMDEVVRLVKALQTA
    DKGYATPANWPNNDFLNEKVIVPPAKDMDGRKKRLDAIESGELQGYDWWFCYTDLKE

    >gi|150402431|ref|YP_001329725.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C7]
    MDVVIVGSGAGGLTTASNIKKHDKNAKVTVITSDNYIAYSPCAIPYVIGKEIADFESIIMHTPEDYKTKGIDVIIEAEVL
    DVVSNENKVIYKKDGTETEIKYDNLVLATGGTPFVPPIEGVNLDGVFKVRTIDDGQKITEWAKDTKNAVVAGAGAIGIEI
    AFGLKELGLDVTVVEMVPQVFPRALDPDMAETVQKYLEEQGIKIILEKPVGKIIGNDKVEAVLVGEETIPAEMVIMSTGV
    RSNIELAKKAGCEIGRWAVLTNEKMQTSIENIYAVGDCVEVIDAITMQNTLSPFGTTAVRQGKVAAKRIAGLEAEIKPVL
    NSMVSKIGSLEIGGTGMTETAAKMNGIEVVLGYSKALTRARYYPGGKAIYIKMVADKNTNRVIGCQIISEERVAERVDAM
    SVAISNGMTVEELANQEFCYAPPVSMVIDPIVFAAEDTLDKF

    >gi|150402502|ref|YP_001329796.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C7]
    MIAVVGGGPAGLSCAHALARRGLEVELYEMDKLGGTCLNYGCRYVNALKEVSDVIDNLNAITGKKHVLEDIISLNELHEK
    VYKIHRSMREGAKKTLDELGIFVKFEEFKEEYEKNYDYVVYATGQNYARNYLGVECAIHSELPYLKKLPKKILIIGGGTV
    AAEYASIFSTFGSEVTVYVRSKFLKKIEDDELRDYIINDLSNFKITHSEEELNKMLHDDEYFNILAIGGTPRYKTNEYFQ
    VDGKSKVYACGDSVRGGYTPISNREGKIVAENIYNEIKNLPLKKMEYGIEIATIRMPISILVVGKQTKDFKTSYNRPGRG
    YYFRKTEKRGMNRIYYENGKAVGAVVMTTATELAPYFAQYLKGIDVYKDFLEVYPTTDPYYWQV

    >gi|150402557|ref|YP_001329851.1| redox-active disulfide protein 2 [Methanococcus maripaludis C7]
    MKIRVFGMGCSKCNETYENVKKAVHELKIDAEIVKITDIKEISEWVLMAPAVAFDEDIIFEGTVPSVNDLKKELEDYLKS
    N

    >gi|150402710|ref|YP_001330004.1| transporter component [Methanococcus maripaludis C7]
    MSYVPAIATLAFGILLGYLGQRSSMCFCGGIRDYYLMKDTWLVKGLFGFVGGALIGSIIFNVIGMLPLFPWIATKGLTAI
    GGDAAGSLGFGAHFIVTIIGGFGVGFLSVIQGG
    CPFRNYVMAGEGNQTAMAYVVGLAVGAIVFHQWVLPFVGSILA

    >gi|150402795|ref|YP_001330089.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus maripaludis C7]
    MIVTDIKKCRTYEECENCKNKEISKCMEVCPTNAIKMIDGKAFSCITCGTCAKECPTGAIKKNEYGGYYVNRKLCTGCGI
    CKNVCPIDIIDIREDSTGKAYPTGMCVM
    CGLCTTECPYNARLYFDPSSLKDTKNKMLMERYSTIFKMMGKTYEFQEPKHV
    KIVNPTERKVRHSISIDTEKCSSCGKCIYSCPKDTIIELEVVDGCTRCNICKDVCPVDAIEYGEVTEN
    CILCGNCITKCP
    KDVLEISEFKVVKTKEDVKAKPEKHCINCGLCVDKCPSNALRFETGKILYDPKTCTLCNTCVKECPQGVRINKGEFVDGG
    CVLCELCIKECPEDAISIKERSKFNLVGKEECIACGTCSMVCPNDAITVKIDSLNLSGNKVHSEVIFNDNCVICEKCAIH
    CPRDVIENTSGYKKIVDRENSYIRTDDDYCVKCGLCTIICPNDAINKGEINTEKCEYCSACVNICPTRAIRIYRTWNEKT
    K

    >gi|150402831|ref|YP_001330125.1| DsrE family protein [Methanococcus maripaludis C7]
    MIKEINVKSLRSPAMLVEKVIEKTDGGILVIETDGDSQIKEISELIKKMGYKMEVDGTDIKVSIGEIEASKSINVVGASC
    PGPILMVGEVLERMAVGEVLEIIAGPNAFTDLTEGLKSMGNDILSAEKTDGGNYKILIKKEEKKKELGVSLDIDEVFIIN
    MTGTGNAEKAYATFMMADVAQNMKLKPTIFLMFDGASLALKGECDKVKHPAFPKLGDKLRAAIKSGVKIYV
    CEMSSEFRG
    VDKKLEDGIEIAGAPTFFRFLSKPNARPVWL

    >gi|150402832|ref|YP_001330126.1| redox-active disulfide protein 1 [Methanococcus maripaludis C7]
    MVKVEVFTSPMCPHCPAAKRVVDEVAKEIDGLEIVHINVMEHPEKAAELGIMAVPTVAINGEVKFVGAPTKDALIAELKK


    >gi|150402896|ref|YP_001330190.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus maripaludis C7]
    MSDPKVGVFVCYCGANINGAVDCEAVKDFASKLDGVVVSATYPFMCADPGQGLIKDAIKEHGLDRIVVAACTPKIHEPTF
    RGCLQDAGISPYYLEFVNIREHDAFVHMGNVKAATNKACEMIAGGVERAKKLEDVPQKVVEVDKSCMVIGAGIAGIQSAL
    DLGDQGFKVYLVDKDESIGGRMAQLAKTFPTDDCAM
    CILAPKMVSAANHPNIELITFAEIKNIDGYIGNFDVTLEKKPRY
    VDEDTCTGCGACAAACPIEVPNEFDLGLGTRKAIYVPFPQAVPLLYTIDKDHCIDCGLCAKVCCAEAVRYDQKPQELKIN
    VGTIITATGYDEFDASRKEEYGYGVYDNVITTLEVERMINPAGPTHGHEIRPSDGKAPKRTVYIQCVGSRDEKVGNPYCS
    RVCCMFALKNAQLMKMHDPNAEVYICYMDIRAFGKGYEEYYKRAQDQFGVKFIRGRPANIIEDPETKNLTVRVEDTLLGE
    ILEIDADLVVLSAGLEAKKDAAELGKMLGIDRGPEGFFKELHPKLAPVNTKVDGIAIAGVAQGPKDIPDTVAQAKGAASA
    VAIPMSQGQFKIEMIRATVNEEVCGGCKVCALMCPYNAITYEEKDGHLVAISDDVACKGCGACAAACPSGAMQLRYYRDE
    QVIGMIDGILNAAKMLEE

    >gi|150402991|ref|YP_001330285.1| methylated-DNA--protein-cysteine methyltransferase [Methanococcus maripaludis C7]
    MKTFNEKCYDLLMQIPKGKITTYKLIAEALNTKAYLAVGNAMKNNPYVLTVPCHRVVHSNGNVGGYVKGIEKKIEILKSE
    GIDISNNKIINLKKYLFRF

    >gi|150403125|ref|YP_001330419.1| redox-active disulfide protein 2 [Methanococcus maripaludis C7]
    MKIKILGMGCKKCTNVYENVKKAVEDLKIDAEIVKITDAAKIAEYIMSTPGVVFDDEVIFEGKVPSVEEIKNELSKL

    >gi|150403231|ref|YP_001330525.1| DsrE family protein [Methanococcus maripaludis C7]
    MKFTVIIGDAPYGKERAYSALRFALTALLEGIDVNIFLLEDGVYVAKKGQAPAGVPDYSELLENSIDAGAVVKACGPCGK
    ARGISEDELLEGITFATMHDLVAFVKEADKTINF

    >gi|150403495|ref|YP_001330789.1| alkylhydroperoxidase [Methanococcus maripaludis C7]
    MDENESFSDEKLSELMEIVKKRYGKIPYIIEKMKNNLKLLESKINYDEAVVDDYKHIDPKTAELISIAVVSALGCDHCIE
    FHIEAAKKMGITEEQIMTAVLIAGSLSNAAVLSKSTRAIQKVNNTLKYNENSISCPECNISGIK

    >gi|150403675|ref|YP_001330969.1| peroxiredoxin [Methanococcus maripaludis C7]
    MAVIGEKFPEVEVITTHGKLKLPEHFIESGKWFVLFSHPGDFTPVCTTEFVAFQKRYDQFRELNTELIGLSIDQVFGHIK
    WVEWIKEKLDVDIEFPIIADDRGALAELLGMISPYKGNNTVRAVFVVDATGTIRAIIYYPQEVGRNMDEVVRLVKALQTA
    DKGYATPANWPNNDFLNEKVIVPPAKDMDGRKKRLDAIESGELQGYDWWFCYTDLKE