Methanococcus maripaludis C6 uid58947

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|159904723|ref|YP_001548385.1| alkylhydroperoxidase [Methanococcus maripaludis C6]
    MNKNSSSSDEKLCELMEIVKKRYGKIPYIIEKMKNNPKLLESKINYDEAVVDDFKHIDPKTAELISIAVVSALGCEHCIE
    FHVEAAKKMGISEEQIMTAVLIAGSLSNAAVLSKSTRAIQKVNNTLKYDENSLSCPECNISGTK

    >gi|159905029|ref|YP_001548691.1| DsrE family protein [Methanococcus maripaludis C6]
    MKFTVIIGDAPYGKERAYSALRFALTALLEGIDVNIFLLEDGVYVGKKNQAPAGVPDYSELLQNSIEAGAIVKACGPCGK
    ARGISEEELLEGITFATMHDLIAFVKEADKTINF

    >gi|159905088|ref|YP_001548750.1| hypothetical protein MmarC6_0701 [Methanococcus maripaludis C6]
    MIPVTISEEAMVFINEKISDTGSKDLIVFFEGFGCGGPKFGIDIASKIVETDEKIYDEDFRIFIDKMARQVLNEVYIIVK
    KSVFSGKYLAVKGAGGCC

    >gi|159905137|ref|YP_001548799.1| redox-active disulfide protein 2 [Methanococcus maripaludis C6]
    MKIIVLGMGCKKCVEVYENAKKAVKELKIDAEISKVTDAAKIAEYVMSTPGLVVDDEVIFEGKVPSVEEIKNELSKL

    >gi|159905264|ref|YP_001548926.1| methylated-DNA--protein-cysteine methyltransferase [Methanococcus maripaludis C6]
    MKTFNEQCYDLLMQIPKGKVTTYKLIAEALNTKAYRAVGNAMKNNPNVLTVPCHRVVNSNGYVGGYVNGVEKKIEFLKNE
    GIDISDNKIINLHGYLFRF

    >gi|159905359|ref|YP_001549021.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus maripaludis C6]
    MSDPKVGVFVCYCGANINGAVDCEAVKDFASKLDGVVVSATYPFMCADPGQGLIKDAIKEHGLDRIVVAACTPKIHEPTF
    RGCLHDAGLSPYYLEFVNIREHDAFVHMGDVKAATKKACEMIAGGVERAKKLEDVPQKVVEVDKSCMVIGAGIAGIQSAL
    DLGDQGFKVYLVDRDESIGGRMAQLAKTFPTDDCAM
    CILAPKMVSAANHPNIELITFAEIKNIDGYIGNFDVTIEKKPRY
    VDDDTCTGCGACAAACPIEVPNEFDLGLGTRKAIYVPFPQAVPLLYTIDKDHCIDCGLCAKVCCAEAVRYDQKPQELKLN
    VGTIITATGYDEFDASRKEEYGYGVYDNVITTLEVERMINPAGPTHGHEIRPSDGKAPKRTVYIQCVGSRDEKVGNPYCS
    RVCCMFALKNAQLMKMHDPNAEVYICYMDIRAFGKGYEEYYKRAQDQFGVKFIRGRPANIIEDPETKNLTVRVEDTLLGE
    ILEIDADLVVLSAGLEAKKDAGELAKMLGIDRGPEGFFKELHPKLAPVNTKVDGIAIAGVAQGPKDIPDTVAQAKGAASA
    VAIPMSQGQFKIEMIRATVNEEVCGGCKVCALMCPYNAITYEEKDGHLVAITDDVACKGCGACAAACPSGAMQLRYYRDE
    QVIGMIDGILNAAKMLEE

    >gi|159905364|ref|YP_001549026.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus maripaludis C6]
    MAGISIQEDACLVCNACAKACPTEAIEIAPFKTCIQCFSCANACPTGALIVKDGKLVFNGSKCDLDGACQKACPTGIKKV
    DNRFPYSKGH
    CVLCEKCVDICPVEIISLPGKAEKPKKEVVIPQEPIAVTKDCVACGVCVPECPVDAISIEDIAVIDTDKC
    IYCTVCSQTCPWNAIFVAGKLPQKRQKTIKSFTVNEEECIGCEKCVEACPGSMIEYNGEALGVKLPVACPACGLCVESCP
    VEAIGLEVEYASAKPVTDEGLVWLEEKCAYCGPCALKCPTGAIKVVNPKGLELPSKKKTEKANEFAMCIRCGACAMKCPT
    GALKMGKVVHEGKEYTRVEFSPALCNECGECVDVCPQKTLELTGDDKMPLKGYCVMCLKCIEACNKTKKEALTLK

    >gi|159905421|ref|YP_001549083.1| redox-active disulfide protein 1 [Methanococcus maripaludis C6]
    MVKVEVFTSPMCPHCPAAKRVVDEVAKEIDGLEVVHINVMEHPEKAAELGIMAVPTVAINGEVKFVGAPTKDALLAELKK


    >gi|159905422|ref|YP_001549084.1| DsrE family protein [Methanococcus maripaludis C6]
    MIREINVKSLRSPAMLVEKVIEKTDVGILVIETDGDSQITEISELIKKMGYKMEVDGTTVKVSIGEIEASKSINVVGASC
    PGPILMVGEVLERMEVGEVLEITAGPNAFTDLTEGLESMGNDILSAEKTDEGNYKILIKKEEKKKEMGVSVDIDEVFIIN
    MTGTGNAEKAYATFMMADVAQNMKLKPTIFLMFDGASLALKGECDKVKHPAFPKLGDKLRAAIKAGVKIYV
    CEMSSEFRG
    VDKKLEEGIEIAGAPTFFRFLSKPNARPVWL

    >gi|159905431|ref|YP_001549093.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus maripaludis C6]
    MIVTDIKKCRNYEECENCKNKEIPECMEVCPTNAIKMIDGKAFSCITCGTCAKECPTGAIKKNEYGGYYVNRKLCTGCGI
    CKNVCPIDIIEIREDSTGKAYPTGMCVM
    CGLCTTECPYGARLYFDPSSLKDTKNKMLMERYSTIFKMMGKTYEFPEPKHV
    KIVKPAERKVRHSISIDPEKCVECGKCVYLCPKDTIIESETIDGCTRCNICNDVCPVDTIEYGEVTEN
    CILCGNCITKCP
    KDVLEISEFKVVKTKEDVKAKPEKHCINCGLCVDKCPSNALRFDEGKILYDPKSCTLCNTCVKECPQGVRINKGEFVDGG
    CVLCELCIKECPEDAISIKERSKFTSIDKEECIACGTCSMVCPNDAITVKIDSLNFSGNTVHSEVIFNDNCVMCEKCAIH
    CPRDVIENTSGYKKVVDMENSYIRTDNDYCVKCGLCNIICPNDAIDKGEINTEKCEYCSACVNICPTRAIRIYRTWNEKT
    K

    >gi|159905516|ref|YP_001549178.1| transporter component [Methanococcus maripaludis C6]
    MSYVPAIATLAFGILLGYLGQRSSMCFCGGIRDFYLMKDTWLVKGLLGFVGGALIGSIIFNVIGMLPLFPWIATKGLTAI
    GGDAAGSLGFGAHFIVTIIGGFGVGFLSVIQGG
    CPFRNYVMAGEGNQTAMAYVVGLAIGAIAFHQWVAPFVASILA

    >gi|159905668|ref|YP_001549330.1| redox-active disulfide protein 2 [Methanococcus maripaludis C6]
    MKIRIFGMGCSKCNETYESVKKAVDDMKIDAEIVKITDIKEISEWALMAPAVAFDEDIVFEGTVPSLNDLKKELEDYLKS
    N

    >gi|159905724|ref|YP_001549386.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C6]
    MIAVVGGGPAGLSCAHALVKRGLEVELYEMDKLGGTCLNYGCRYVNALKEVSDLIDNLNAITGKKHDLEDIISLNELHEK
    VYKIHKSMREGAKKTLDEMGIFVKFEEFKESYEKNYDYVVYANGQNYAKNYLGVECATHSELPYLKKLPKKILVIGAGTV
    AAEYASIFSTFGSEVTVYTRSKFLKKIEDDEIRDYIINDLSNFKITHSEEELKKMLNDDEYFNILAIGGTPRYKTNEYFQ
    VDGKSKVYACGDSVRGGYTPIANREGKIVAENIYNEINSLPLKKMDYGIEIATVRMPISILVVGKQTKDFKTSYNRPGKG
    YYFRKTEKRGMNRIYYENEKAVGAVVMTTATELAPYFAQYLKGIDVYKDFLEVYPSTDPYYWQV

    >gi|159905797|ref|YP_001549459.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C6]
    MDVVIVGSGAGGLTTASNIKKHDKNAKVTVITSDNYIAYSPCAIPYVIGEEIADFESIIMHTPEDYKAKGIDVIIEAEVL
    DVVSDQNKVIYKKNGTEEELKYDNLVLATGGTPFVPPIEGVNLDGVFKVRTIDDGQKITEWAKGTKNAVVAGAGAIGIEI
    AFGLKEIGLDVTVVEMVPQVFPRALDPDMAETVQKYLEEQGIKVILEKPVGKIIGNDKVEAVLVGEETISAEMVIMSTGV
    RSNIELAKKAGCEIGRWAVLTNAKMQTSIPNIYAVGDCVEVIDAITMQSTLSPFGTTAVRQGKVAAKTIVKLEAEIKPVL
    NSMVSKIGKLEIGGTGMTETAAKMNGIEVVLGYSKALTRARYYPGGKPIYIKMVADKNTKKVIGCQIISEERVAERVDAM
    SVAIFNGMTVEELANQEFCYAPPVSMVIDPIVFAAEDTLDKF

    >gi|159905879|ref|YP_001549541.1| peroxiredoxin [Methanococcus maripaludis C6]
    MAVIGEKFPEVEVITTHGKLKLPEHFVEAGKWFILFSHPGDFTPVCTTEFVAFQKRYDQFRELNTELIGLSIDQVFGHIK
    WVEWIKEKLDVDIEFPIIADDRGELAVTLGMISPYKGNNTVRAVFVVDATGTIRAIIYYPQEVGRNMDEVVRLVKALQTA
    DKGYATPANWPNNDFLADKVIVPPAKDMDGRKKRLAALESGELEGYDWWFCHTDLKE

    >gi|159905889|ref|YP_001549551.1| heavy metal translocating P-type ATPase [Methanococcus maripaludis C6]
    MDVKLKISGMTCAVCVKTIEKSVSKMEGVKNITVNLLDESAVINFNEKIVSIEDIGIKIERLGYEVLGIAEEVEELPEKE
    GELKEKLKKIILGAVFSIALFSMMYLEIPYKPYLAFLVSLPPLIYIALPIFKVGFNSLKVKSLNMDVMYSLGMGVAYVSA
    LLVTLGFLPMNFMFYDTTIMLATLLTLGRYLEERAKGRTSEAIKKLMGLQVKTAKVIRNDEELEIPIEDVIVGDLILIRP
    GEKIAVDGTVFEGDSYVDESMITGEPIPNPKKKGDSVIGGTINKNGILKITAKKIGKDTVLSQIIQLVKNAQISKPDIQN
    LADKVVSYFIPAVFTIALISSIYWFFNGGILLAVTTFISVMVIACPCALGLATPTAITVGIGRGAELGILIKDSKVFDVA
    GNLKCMIFDKTGTITKGEPEVDEIITDYSKEELLLIAGSFEKNSEHPLALAIVKRADELNISLSEPEKFESITGMGVSGV
    LNEQKIFIGNRRLMDENNILINEKYNKEISRLEENAKTVIIVAIKNNIIGIIAISDKIKENAKTTVQNLREMGIESYLVT
    GDNEKTAKVIGKEVGILENNIFSNVLPEKKAEIVKSIKENAGGYVEFIGDGINDAPALSTADVGIAVGSGTDIAIESGEV
    VLMNEDLKYVTGFVKLSKRVLKQIKLNLFWAFAYNSVLIPVAAGALYSYNIRFEPELAAFAMTLSSVTIIGLSLLLKKYD
    PWK

    >gi|159906078|ref|YP_001549740.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C6]
    MAYDLIIIGGGPAGLTAGIYAMRAKLSTLCLEKENEGGKIAEAGIVENYPGFESIKGFELAQKFSEHAKHFELPIIHEEV
    EKIDTSSKPYKVITKNEKYEAKSIVIASGSRYKKPGLNEDDFNGKGVCY
    CVMCDAFFFLNKEVIVLGRGTSAIMAAYNLK
    DIAKKITIVTDRSELKAVEKIMEDRMNLMNNLEIVYNAEPIEIVGEEKAEGVKVSINGKEEIISADGIFISFGYVPNTEF
    LEKSDIKLNKRKFVEIDENCKTSVDGIYACGDVTGGILQVSKAVGEGVTAFTGALSSIQK

    >gi|159906079|ref|YP_001549741.1| thioredoxin domain-containing protein [Methanococcus maripaludis C6]
    MKHFLNFLVLILLIGVTGCISTQETASDLTDETMMIEFYSTNCPACTKLSPYLDELEDEGYSISRINVNNNGQMAIGYGI
    NLVPTVVFIKDGKEVDRVIGNQPEVIKSKAEEYFK

    >gi|159906132|ref|YP_001549794.1| selenophosphate synthetase [Methanococcus maripaludis C6]
    MVKIEEEIKLTQMVTLHGCACKLPDTELENLVKGIISEDDLKHTKVGLGDDAAVVIKNGMAIVKTIDVFTPIVDDPYLQG
    RIAACNSTSDVYAMGISEIIGGLVFLGIPPELPVSVAKKMLQGFQDFCRENDTTIIGGHTILNPWPLIGGAITGVGKEEE
    ILTKAGCKNGDVLILTKPLGNQSAMALSRVTEEFEDLIDIPKEEQKYILEKTIELMTTSNRIALLQLRELENELGEKIAN
    AMTDVTGFGILGHSQEMAEQSNVEIEISCLPVIKGTPELASLFGHALCSGKGAETAGGLLISTKPEYKDKLIQKFEENNI
    YAFEVGKIVNNGVGISKLSENVEILEI

    >gi|159906190|ref|YP_001549852.1| peptide methionine sulfoxide reductase [Methanococcus maripaludis C6]
    MTNTETAVFGMGCFWSAEELFRKINGVISTEVGFMGGNIKNPTYGQVCRGRSGHIEVVNIIYNPKILKYDDLLELFWNNH
    DPTTPNRQGWDVGEQYSSHIFYFTEEQKLLAEKSFEKIQKNSELKIVTAIRKASDFFPAEEYHQKYFMKKNNCILNF