Aeropyrum pernix K1 uid57757

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|118430838|ref|NP_146899.2| putative mercury ion binding protein [Aeropyrum pernix K1]
    MIIFKRHSQAILFSHNKQEKALLGIEGMHCEGCAIAIETALKNVKGIIDTKVNYSRGSAIVTFDDTLVSINDILEHYIFK
    VPSNYRAKLVSFIS

    >gi|14600438|ref|NP_146952.1| thiol peroxidase [Aeropyrum pernix K1]
    MPGVGEQAPDFEGIAHTGEKIRLSDFRGRIVVLYFYPRAMTPGCTREGVRFNELLDEFEKLGAVVIGVSTDSVEKNRKFA
    EKHGFRFKLVSDEKGEIGMKYGVVRGEGSNLAAERVTFIIDREGNIRAILRNIRPAEKHADLALEEVKKLVLGKKAERAG
    EVI

    >gi|14600604|ref|NP_147121.1| truncated thiol peroxidase [Aeropyrum pernix K1]
    MLSVGDPAPDIEIQLIDGSTIRLSQLRGRSVVLYFYPKAFTPGCTREAIGFNGLYEEFKKLGAEVIGVSMDPPGRNRRFA
    QNYGVRFRLASDVEGEAFKSFWGAQRPRTD

    >gi|14600860|ref|NP_147384.1| thioredoxin [Aeropyrum pernix K1]
    MMVASTFVVVFQGFGLTAPQGGGSSPSGGGEEGGLEEPQGLFPTVSYTLPLAGGDRLVYESTSTSASGTNVATNAVSIVE
    PGWPESSVEVQLLEAGDPVVTSTPEKGVLTTTLLALPKEYLGMQEIVIPVYIPPGRSGLCMRLTLEAGEAGGYTYRGYAN
    VGDYTIAVKAVYRGDGILEAFEAGIVGGGLSIRYTQSLVEASVSGSDTMVSVEWECTADGFSSNLSYVKEGLAVLEDGRL
    IYITPEEFRQLLQGDAILAVYSKT
    CPHCHRDWPQLIQASKEVDVPIVMFIWGSLIGERELSAARLEMNKAGVEGTPTLVF
    YKEGRIVDKLVGATPWSLKVEKAREIYGG

    >gi|14600959|ref|NP_147485.1| protein-disulfide oxidoreductase [Aeropyrum pernix K1]
    MARYYVLDLSEDFRRELRETLAEMVNPVEVHVFLSKSGCETCEDTLRLMKLFEEESPTRNGGKLLKLNVYYRESDSDKFS
    EFKVERVPTVAFLGGEVRWTGIPAGEEIRALVEVIMRLSEDESGLEDATKEALKSLKGRVHIETIITPS
    CPYCPYAVLLA
    HMFAYEAWKQGNPVILSEAVEAYENPDIADKYGVMSVPSIAINGYLVFVGVPYEEDFLDYVKSAAEGRLTVKGPIRAGEA
    EEL

    >gi|14601102|ref|NP_147629.1| methylated-DNA-protein-cysteine methyltransferase [Aeropyrum pernix K1]
    MARPGHSGRVTPGLISNPEVKPAALEAPVGSERPCRGLQAGAGPLQRPVPTMSPATSSLIVYTLLHLIPPGKVTTYSSLA
    RASGLSPRAVGRILARNPSPIAVP
    CHRVVRSDGSIGGYSMGGPRVKAALLKLEGVRLYRSGGSWRVHPEDIVDLSSILLD
    PPEGSAEALSTVKAD

    >gi|118431317|ref|NP_147693.2| thioredoxin reductase [Aeropyrum pernix K1]
    MPLRLSAVRAPKIPRGEEYDTVIVGAGPAGLSAAIYTTRFLMSTLIVSMDVGGQLNLTNWIDDYPGMGGLEASKLVESFK
    SHAEMFGAKIVTGVQVKTVDRLDDGWFLVRGSRGLEVKARTVILAVGSRRRKLGVPGEAELAGRGVSY
    CSVCDAPLFKGK
    DAVVVVGGGDSALEGALLLSGYVGKVYLVHRRQGFRAKPFYVEEARKKPNIEFILDSIVTEIRGRDRVESVVVKNKVTGE
    EKELRVDGIFIEIGSEPPKELFEAIGLETDSMGNVVVDEWMRTSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYT
    YLQEKGLYKPKPLTGLK

    >gi|118431463|ref|NP_147955.2| cation-transporting ATPase [Aeropyrum pernix K1]
    MSGVTLVKEKLSIKGMHCATCGLTVEKALRSLPGVVEASADPVTGEAVIAYEPGSVRLSDVVKAIRSVGYDVVLAEAVIR
    VPSMSSIDDERVVEETLLKMKGVAEVYASHTNKTVVVRYNPHATKPEEVLEALRKAGYKAEMAEGKSLVEAEAEEERRLL
    LDGLISITASIVYYILLALERLAGVEAAGAVLPYYGAVVFAIVLLGPGRRFLVGAYRSLKNGTPGMDALVSLGTLSIYFY
    SLAATLNIIRGELYYEGIGLIIGFVLIGRYIESKVKKGTGKAVENLAKLKPQKARVLRGRREVEVDVSEVKPGDLVVVRQ
    GERIPVDGYVVQGKAYVDESVFTGEPIPVEKKPGDLVLAGSMVSSGWLHISATRTSGDTAIDRIARLIAYSQAGKMDIQR
    LADRVSGMFFWAVLCIASLTFTAWLFLGGLETAIIRAASVFLISCPCALGLATPTASSAGVGVAARAGILVRNVVAFERL
    AKASIVVFDKTGTLTLGMPRVAAVEAVDGYSEKEILELAASAEKWSEHPLARAIIDAYMEVAGRGPEDPDNAEVFPGMGV
    YAEVGGRSVVVGNRKIMDGFEVDIKTLEKIAEEWQSRGATTVFVAIDGKPAGVIAIRDEPRPEARETVDWLEKLGLKVMM
    LTGDSEGTARAIARELDIEEYRAGVSPEGKAEVIRELQKKGHVVVMVGDGVNDAPSLARADVGIAVANATDVSVEAGDIV
    LIKGDLRRVPLAVVISRKTYNTIKFNLFWAFIYNVTLIPVAAGAFAWAGITLRPELAAAAMALSSITVTSISYRLSKWKP
    RLPGDYETYDNKEEKEESKEEFERITREEKALAAGRQQ

    >gi|14601420|ref|NP_147957.1| mercuric reductase [Aeropyrum pernix K1]
    MLRSEYDIIVIGGGAAGFSAVVAAAEGGASVLLVSEGPLGGTCVNFGCVPSKHVLYNLSTARKAGLKISLSEALEGARKV
    SETLRKEKYESLLDSLGVDYLRGRARFKAPGIVEADGREVRYRKAAIIAVGARTWRPPIPGLKEAEKAGRILDNERLFGE
    GPPPDMESVAVIGGRAQGVEAAQIFARSGLKTVLLQRSGRLLPRDEPEAGVYMKRVLEGDGVEVRTSARPLRVESVRGAV
    RIDYETPQGPASVEASYIYLATGRKPVLDGLGLENVGVRVSSDGFIVVNEKLMASPGVYAAGDCIGGIQLEPVAAREGYV
    AALNALGGNVEMDYTVIPRAVFTDPEFASVGLTERELARKLGVCACRTVDITQIPRARIMGYETGFVKMVVDPRTKKVAG
    VHMMAPQAAEAIHEAAFILKAGMTVDDVIDTIHIFPSISEGIKYAALAFYRDVSKMPCCLL

    >gi|14601507|ref|NP_148046.1| putative ATP-dependent adenyltransferase [Aeropyrum pernix K1]
    MEEKVAWEPLDVRAIERLDLNVYSRQLGLLGVRGQLRLSSSKVAVVGLGGLGNLAAAYLAASGVGRLILVDRDVVEPSNL
    NRQVLYGKGDVGRYKAVAAAERLGELNPEAEIEPVPEALDPALAEDLAREADVIVDGLDNWMARLWLDAASWRRGKPLVH
    GAAERMHGQVTTVERGRSSCLACIAPSNPERAG
    CTTIIAPTVGVVSSLEVLEAIKLLTGVGEPLYNRLAVIDLTTPRIEV
    LRLAQMDCRACLSRLKGGEDLASLYGV

    >gi|118431550|ref|NP_148088.2| dihydrolipoyl dehydrogenase [Aeropyrum pernix K1]
    MERFDLVVVGGGPGGYPAAVRAAQEGLNVALVEMDSLGGECTNYGCIPTKALLHPAGLVASLARLKFVKGSVDVDFKGLM
    EWVDSVVKGVSNGVSTLLKGYGVEVVKGRAKIRPGVVEVDGSGSIGYSKLVLALGTSPASIPGLEPDGEVVHNNRTILGL
    RRKPGRMLIVGGGYIGVEYATAMARLGVEVTIVELLDRLLPNMQRDFSRVVERRLRAEGVKIHTKSKVEAVERRERYAVV
    EVSGVGKMEYDAILVAVGRRPNTGDVGLEKLGVKLDKAGYIQVDGATLETGVPGVYASGDVTGPPLLAHRAFLQAVVAAE
    RAAGDSSAAFDAKAVPAVVYTDPELATVGLTLEEARAAGVDAAETRLPLASLPRVGAIEGCRECFAKVVYDRSSRAILGF
    HVAAPHASEIIAEAALAIEMGATLEDLALTIHPHPSVSEALKEVAELALERPIHYILRRGGARR

    >gi|118431562|ref|NP_148108.2| hypothetical protein APE_1701.1 [Aeropyrum pernix K1]
    MQGIRVKIYVHKTCASSYSLFRGLREKGLLERVEIVEAKAPLDERGRLIWSVPWVLFDGEVLAGDPVDPVVIESAVKGSK
    IDVGDPVEAFMETILHSSLASSIAVLSQSLEPVLDVSLASAAVRSPLSGLNPRDVLKSVEARASELYSEWSGKLARALAI
    GFVRELWWARGGTLDPGGLESIVSSGGFRLWLLAKGSLGRVGLPADPRLVAGYREVGEAEDFLLKTGPALIRRVEREQTG
    ILGDREWMSL

    >gi|14601584|ref|NP_148124.1| thioredoxin [Aeropyrum pernix K1]
    MGKGGRSRLRLSAGSEAVSLGGLFKLATVIFVAVVLLSFMAVESAKTENMIFLDDPREYWSVVKSYDKVLVYVGQTGCLG
    CKKIEPAIERFATEQGEVKVVKVWLDTLIKVDAESTFDLLARLGVEGTPTLIVYRNGVEVARHVSTFGFGDQYGPLKEFV
    EKSLSGEVFIMNYSTPGQAYLVKDTFDPKLIASVTLAGFLLGLVAAFSPCSLPMVAAFASQSVSESLRFKSYVVNLAAIL
    SAAIGFGTILSLLYLASIFIPLNIYQLAIYYAASVIIAWGILTLAGKDVMIRSKKTAKILLPVLGLQCSLPFLLTAIALA
    SQAPHLVIAGSIAFAAGYALPYSLAGALGASAGLKIERIMRASVMKYLQGILLIGAGAYLIYYNMPSII

    >gi|118431740|ref|NP_148402.2| thiol peroxidase [Aeropyrum pernix K1]
    MVELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKMAQLEKANAEVLAISVDSPWCLKK
    FKDENRLAFNLLSDYNREVIKLYNVYHEDLKGLKMVAKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVREANKIAGELV
    A

    >gi|118431781|ref|NP_148460.2| hypothetical protein APE_2211.1 [Aeropyrum pernix K1]
    MAGSSEKFKIVLKPVTAEAVPSGDAVKVTTGGVQIDVYPEREAGGPERGLTPLGLLAASLASCEVLMSRLVGRMLGYNGF
    DVRVAVTADVQVAEGLRSLSIRYVFKGVDIDTANLIVSKVKEL
    CPVYNSLVRNGVSVEENVEVE

    >gi|118431808|ref|NP_148504.2| thioredoxin [Aeropyrum pernix K1]
    MDQSGGLRLGGRSSLTLGMVVLFGVALGGAILGFLAGELSQTSLVYSSQCYLKSSSQLEGLVEASGRIAVMFSSETCPTC
    KVIEPVWTELCESGGYKGVRLAVIKLDNDTADAFLKNNVTGTPTFILFENGKELSRYVGAFKGDIEDGIKEWIDASLRQD
    GASGGTTEIFGGSATPVNTSSQGAILSLSSTVTIMTAFLAGFIAALSPCVLPVLYSYITGLGVSSGGKPPVHAIILAPML
    AALGAASIGALFLGLGSVLEPFRQALLFAASIVLVSAGILELMGIPTYTAIRIRSGGGLFGFSLLYGVLSVQCSLPLVLG
    GLLLVAGGGLEAGLISLAAFSIGIGMPVAIAVAAVRTGIARVPGILGSARLLKAGYLAVSIGGVYMLAYSLGVI

    >gi|14601964|ref|NP_148509.1| thioredoxin peroxidase [Aeropyrum pernix K1]
    MPGSIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVF
    SHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKA
    LKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRCLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKL
    LYEEARTHLH

    >gi|118431868|ref|NP_148604.2| thioredoxin [Aeropyrum pernix K1]
    MWCSDRMGETVSGSLYQVARTLKDELLKIGDIISRRSSQILVDIDNENLPKVLSQHRVAVILFTAEWCGRCILMQDILTR
    IASRLFRDDIVFGRVDVDRAFSLAERYGVQHIPTTLIIVEGRVVDALVGSVSEEKLLERINRELTDIEKGGKRIAEKSK

    >gi|118431901|ref|NP_148649.2| thioredoxin [Aeropyrum pernix K1]
    MEIDPELREILRKKAASIVVEASTCCRIDYEGPVAEVLDPRELREMLDNCRVVIAFFYTPTCPYCRMLKPVFEEAARFYR
    GKALFAAVNLARFPFMSDALGIMGTPTIIAFVRGREAGRLVGLMPPERLEAFVEAVLDAGGCV

    >gi|118431916|ref|NP_148674.2| hypothetical protein APE_2533.1 [Aeropyrum pernix K1]
    MTGGPECSRPNRLAEAGSRYLRQHSCDPVDWMPWGAEAFEKARRLDKPVFVSVGYSSCHWCHVMQRESFSDPMVAEVLNR
    AFVMVKVDREERPDVDTLLMRYCAIASGSCGWPLNVLLTPDGKPFYVATYLPKESLVALAVSLERVWRERRAEVLEVAER
    AGGLLEQHRLAFTPGRIPRPGEILGKAVSSLEKVYDTAYGGFGRGMKFPMHHALLLLARASMAGDRRALNMLTGTLDHML
    FSGVHDLVEGGLHRYSVTRDWRLPHYEKMLYDQAWIIQVLAEAYAASGDRLYLDFAVSTLEFAMSWLWTGRGFASSVDAD
    TGEGEGAYYTFTLEEAEAEGGLPPEAIGLFNLSREGNVFEEATGARTGRNILHVGGRLDRAAEMLGLSPDRAWEVLEESR
    RILLRIRSRREKPGVDDKVLTDWNGMMLHALAHLYWVSRDPEVLGVAKSLKALVKDRMNGDGISHVCYSGGECVEGMLPD
    YAYTAAALASLYTVSGDTEALGAAKSLAKGMIDLLWSPGGGYFRLSPPGPHTPEVPAEAEDTAYPGAYATAIHALLLIHR
    ATGWMKAREVAMKSLKRLASRLEQEPAAHATLALATLNLAPLAVEVAAPGVAEDFRVKVLESVYNPYMVIHTYMKPEDLR
    GLVEYAASMTTMGGSPAFYICHGGVCKEPLRDEDRALEEVMRLSKKAG

    >gi|118431925|ref|NP_148697.2| hypothetical protein APE_2568.1 [Aeropyrum pernix K1]
    MGARQAVIVTAAIVLLLVAGYTAYTIAIPRAAGHSEEVLEREASFSLTTIDGEVISLNNVGGDVVILWFMAAWCPSCVYM
    ADLLDRLTEKYREISVIAIDFWTAEALKALGLNKPGYPPPDTPEMFRKFIANYGDPSWIMVMDDGSLVEKFNVRSIDYIV
    IMDKSSNVLYAGTTPSLGELESVIKSVQGG

    >gi|118431935|ref|NP_148714.2| thiosulfate sulfurtransferase [Aeropyrum pernix K1]
    MGADYPGPLVSIEWLEANIKRSDVKVIEVDYDPATAYFIGHIPGALLIDWKRDLNKYPERDIIDPEGFERLMSRLGVENG
    DHVILYGDYNNWFAAFAYWVFKMYGHQRVSLLDGGRSKWIALGKPMSRPATREPPRAERESRYRVVTVDSRYRVFFLDIL
    RKLNDPNTVLVDVRSPEEYRGDITAPPEYPEEQAQRGGHIPGALNIPWKQAVRDDGSFKSPEELRSLYEDRGVTPDKEVI
    VY
    CRIGERASHTWFVLKELLGYPNVAVYDGSWSEWGNMVRAPVKKGDEP