Methanococcus maripaludis C5 uid58741

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|134045083|ref|YP_001096569.1| transporter component [Methanococcus maripaludis C5]
    MSYVPAIATLAFGILLGYLGQRSSMCFCGGIRDFYLMKDTWLVKGLLGFVGGALIGSIIFNVIGMLPLFPWIATKGLTAI
    PGDAAGSLGFGAHFIVTIIGGFGVGFLSVIQGG
    CPFRNYVMAGEGNQTAMAYVIGLAIGAIAFHQWVAPFVASILA

    >gi|134045235|ref|YP_001096721.1| redox-active disulfide protein 2 [Methanococcus maripaludis C5]
    MKIRVFGMGCSKCNETYENVKKAVEESKIDAEIVKITDIKKISEWVLMAPAVAFDEDIIFEGTMPSVNDLKKELEDYLKS
    N

    >gi|134045306|ref|YP_001096792.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C5]
    MIAVVGGGPAGLSCAHALARYGLKVELYEMDKLGGTCLNYGCRYVNALKEVSDLIDNLNTITGKKHDLEDIISLNELHEK
    VYKIHRSMREGAKKTLDELGIFVKFEEFKEEYEKNYDYVIYANGQNYAKNYLGVECAIHSELPYLKKLPRKILIIGAGTV
    AAEYASIFSTFGSEVTVYVRSKFLKKIEDDEIRDYIINDLSNFKITHSEEELKKMLYDDEYFNILAIGGTPRYTTNEYFQ
    VDGKSKVYACGDSVRGGYTPIANREGKTVAENIYNEINNLPLKKMDYGIEIATIRMPISILVVGKQTKDFKTSYNRPGKG
    YYFRKTEKRGMNRIYYENGRAVGAVVMTTATELAPYFAQYLKGIDVYKDFLEVYPSTDPYYWQV

    >gi|134045377|ref|YP_001096863.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C5]
    MDIIIVGSGAGGLTTASNIKKHDKNAKVTVITSDNYIAYSPCAIPYVIGEEIADFESIIMHTPEDYKAKGIDVIVEAEVL
    DVVSDENKIIYKKDATETELKYDNLVLATGGTPFVPPIEGVTLGGVFKVRTIEDGRKITEWAKDTKNAVVAGAGAIGIEI
    AFGLKELGLDVTVVEMVPQVFPRALDPDMAETVQKYLEEQGIKVILEKPVGKIIGNDKVESVLVGEETIPAEMVIMSTGV
    RSNIELAKRAGCEIGRWAVLTNEKMQTSIPNIYAVGDCVEVIDAITMQNTLSPFGTTAVRQGKVAAKTIANIEAEIKPVL
    NSMVSKIGKLEIGGTGMTETAAKMNGIEIVLGYSKALTRARYYPGGKPIYIKMVADKNTKKIIGCQIISEERVAERVDAM
    SVAIFNGMTVEELANQEFCYAPPVSMVIDPIVFAAEDTLDKF

    >gi|134045391|ref|YP_001096877.1| formylmethanofuran dehydrogenase, subunit F [Methanococcus maripaludis C5]
    MKNFKKDENDGVIEISRSGVEKRVLKWDDCTCVGCGICSEICPTSAIEMGPLGAIFKGELDAPKLDISEKCVLCGMCACA
    CPFDAVKLSINDKPITEMPQYPKIKRGIELNQSKCVLCEQCELVCPQCAIDVEREVPERKSLVLGEITIKKDDCVLCGIC
    AEYCPAEAIELIPNDMNALSLNPIADIKIDLDACVYCKVCEKACPHNAIEAICYK
    CPLASKIKEPELYKEIKGQTNIDKD
    LCVSCGWCANICPADAIEVEKPFEGELIIDEPACNACGACISVCPCNALVFPKPEKQGDKVPNVMVNQDVCILCGACTHS
    CPVDALTVKRTNINMTEANAPAWKKAFSKLIK

    >gi|134045457|ref|YP_001096943.1| peroxiredoxin [Methanococcus maripaludis C5]
    MVVIGEKFPEVEVITTHGKLKLPEHYIEAGKWFVLFSHPGDFTPVCTTEFVAFQKRYDQFRSLNTELIGLSIDQVFSHIK
    WVEWIKEKLDVDIEFPIIADDRGELAVKLGMISPYKGNNTVRAVFVVDATGTIRAIIYYPQEVGRNMDEVVRLVKALQTA
    DKGYATPANWPENDFLNEKVIVPPANNMDARKNRLEACKSGELEGYDWWFCYTDLKE

    >gi|134045466|ref|YP_001096952.1| heavy metal translocating P-type ATPase [Methanococcus maripaludis C5]
    MEVKLKISGMTCAVCVKTIEKSVSKMDGVESITVNLLDESAVINFDEKIVSIEDIGIKIESLGYEVLGIAEEVEELPDKD
    VELKEKLKKIIVGAIFSIALFSMMYLEIPYKPYLAFLVSLPPLIYIALPIFKVGFNSLKVKSLNMDVMYSLGMGVAYVSA
    LLVTFGLLPMNFMFYDTTIMLATLLTLGRYLEERAKGRTSEAIKKLMGLQVKTAKVIRNDEELEIPIEDVIVGDIIFIRP
    GEKIAVDGTVFDGDSYVDESMITGEPIPNPKKKGDSVIGGTINKNGILKITAEKIGKDTVLSQIIQLVKNAQISKSGIQN
    LADKAVSYFIPLVFTIAIVSSLYWFFNGGILLAVTTFISVMVIACPCALGLATPTAITVGVGRGAELGILIKDSKVFDVA
    GNLKCMIFDKTGTITKGEPEVDEIITDYTKEELLVIAGSFEKNSEHPLAIAIVKKADELNISLQEPEKFESITGMGVIGV
    LKDQRVFIGNRRLMEENNLSINEDYNKKISRLEENAKTVIIVALENKIIGIIAISDKIKENAKITIQNLREMGIESYMIT
    GDNEKTAKVIGKEVGILEDHVFSNVLPEKKAEIVKSIQETAGGYVEFIGDGINDAPALSTADVGIAVGSGTDIAIETGEV
    VLMNDDLKYVTGFVKLSKRVLKQIKLNLFWAFAYNSILIPVAAGALYSYNIRFEPELAAFAMTLSSITIIGLSLLLKRYD
    PWK

    >gi|134045695|ref|YP_001097181.1| CoB--CoM heterodisulfide reductase subunit A [Methanococcus maripaludis C5]
    MEEPKIGVYVCHCGVNIGGVVDCENVARTAEGLENVVIARDYKYMCADPGQELIKKDIKELGLNRVIVAACSPRLHEPTF
    RRCVEEAGLNPFLFEFANIREHCSWVHMKEKEKATEKANDLVRMAVAKARQLEPLDYLNVPVTKRAMVIGAGVAGIQAAL
    DLGDAGYETIVVEKTPSVGGRMAQLDKVFPTNDCSI
    CILAPKMVDVAKHPNIKLYSYSEVKDVKGYIGNFKVKIEKKPRY
    LSEEKCTGCGSCEEVCPISVPNEFDMGIGLRKAIYKPFPQAVPAKYTIDKESCIDCGLCAKVCGPQAIDYGQKPEIIEAD
    VGTIISAIGYDPYDPTEKEEYGYGKIPNVITSMELERMINASGPTMGKVIRPSDGQKPKRIAFIQCVGSRDAKIGKKYCS
    NVCCMYAMKNSQLIKEKAPETDIDIYYMDIRAFGKGYEEFYERSSKQYGIKFIRGRPAQVLDNPDGDNPIIRSEDTHLGE
    IFENEYDLVVLSVGMVPTSTADEVQKLLGVSRSADRFFMEAHPKLKPVDTATDGIYLAGACQGPKDIPASVAQGSAAASR
    AAIPLAKGEVQVEPIVVTIDENVCGGCGICVQQCPYGAPRFVEKDGKVVAEVLSALCKGCGTCAAGCPSGALEQSHFKTS
    QIYGQIEGAFKDSY

    >gi|134045750|ref|YP_001097236.1| selenophosphate synthetase [Methanococcus maripaludis C5]
    MNVIISLKGDKIEEEINLTQMVTLHGCACKLPDTELENLVNGIISEDDLKHTKVGLGDDAAVVIKNGMAIVKTIDVFTPI
    VDDPYVQGRIAACNSTSDVYAMGISEIIGGLVFLGIPPELPVSVAKKMLQGFQDFCRENDTTIIGGHTILNPWPLIGGAI
    TGVGKEEDILTKAGCKNGDVLILTKPLGSQSAMALSRVSEEFEDLIDIPKEEQKYILEKTIELMTTSNRIALLHLRDLEN
    ELGEKIANAMTDVTGFGILGHSQEMAEQSDVEIEISCLPVIKGTPELASLFGHGLCCGKGAETAGGLLISTKPEYKNKLI
    QKFKKNNVYAFEVGKIVNNGVGISKLSENVKILEL

    >gi|134045821|ref|YP_001097307.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C5]
    MVYDLIIIGGGPAGLTAGIYAMRAKLSTLCLEKENEGGKIAEAGVVENYPGFESIKGFELAQKFSEHAKQFELPIIHEEV
    EKIDTSSKPFKVITKNEQYEAKSIVIASGSRYKKPGLNEDDFMGKGVCY
    CVMCDAFFFLNKEVIVLGRGTSAIMAAYNLK
    DIAKKITIVTDRPELKAVERIMEDRMNLMNNLEIVLNAEPIEIVGEEKAEGVKVSINGKKEIISADGIFISFGYVPNTEF
    LEKSDIKLNKRKFIEIDKNCKTSADGIYACGDVTGGILQVSKAVGEGVTAFTGALSSIQKE

    >gi|134045857|ref|YP_001097343.1| redox-active disulfide protein 2 [Methanococcus maripaludis C5]
    MKIIVLGMGCKKCMDVYENVKKAVEELKIDAEIAKVTDAAKIAEYVISTPGLVVDDEVIFEGNVPSVEEIKNELSKL

    >gi|134046080|ref|YP_001097566.1| alkylhydroperoxidase [Methanococcus maripaludis C5]
    MNENSSISDEKLFKLMEIVKKRYGKVPYIIEKMKTNPKLLESKINYDEAVVDDYKHIDPKTAELISIAVVSALGCEHCIE
    FHIEAAKKMGISEEQIMTAVLIAGSLSNAAVLSKSTRALQKVNNTLKYDENSLSCPECNILGTK

    >gi|134046138|ref|YP_001097623.1| peptide methionine sulfoxide reductase [Methanococcus maripaludis C5]
    MTNTETAVFGMGCFWSAEELFRKIKGVISTEVGFMGGTVKNPTYGQVCRGKSGHIEVVNITYNPKIVKYTDLLNLFWNNH
    DPTTPNRQGWDVGEQYSSHIFYFTEEQRLLAEKSFEKIQKSSDLRIVTAIKKASDFFPAEEYHQKYFMKKNNSILNF

    >gi|134046392|ref|YP_001097877.1| DsrE family protein [Methanococcus maripaludis C5]
    MKFTVIIGDAPYGKERAYSALRFALTALLEGIDVNIFLLEDGVYVGKRNQAPAGVPDYSELLENSIEAGAVVKACGPCCK
    ARGISEEELLEGITPATMHDLIAFVKEADKTVNF

    >gi|134046598|ref|YP_001098083.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus maripaludis C5]
    MSYNDEEFNKIFTKGKFLKNIIFNLFKPYKNPKFIGETKNPELDECICCGLCVDVCPTNAISVFKFRDIICEHCGACANA
    CPVDAIEKNRYSVDPEKCIKCGYCSIFCTIPILKNEMPIPKVPEVTKECNNCKLCIQKCPKKAISFENGKISINPEKCNL
    CMKCVEFCPLNALLSPQDALKSKIIKVDLNSCIFCKDCEEVCPVK

    >gi|134046634|ref|YP_001098119.1| methylated-DNA--protein-cysteine methyltransferase [Methanococcus maripaludis C5]
    MKTFNEQCYDLLMQITKGKVTTYKLIAEALNTKAYRAVGNAMKNNPNVLTVPCHRVVNSNGYVGGYVNGIEKKIELLKNE
    GIYISDNKIINLSGYLFRF

    >gi|134046735|ref|YP_001098220.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus maripaludis C5]
    MSDPKVGVFVCYCGANINGAVDCEAVKDFASKLDGVEVAATYPFMCADPGQGLIKDAIKEHGLDRIVVGACTPKIHEPTF
    RGCLQDAGISPYYLEFVNIREHDAFVHMGDVEAATKKACEMIAGGVERAKKLEDVPQKVVDVDKSCMVIGAGIAGIQSAL
    DLGDQGFKVYLVDRDESIGGRMAQLAKTFPTDDCAM
    CILAPKMVSAANHPNIELITFAEIKNIDGYIGNFDVTLEKKPRY
    VDEDICTGCGACAAACPIEVPNEFDLGLGTRKAIYVPFPQAVPLLYTIDKEHCIDCGLCAKVCCAEAVRYDQKPQELKIN
    VGTIITATGYDEFDASRKEEYGYGVYDNVITTLEVERMINPAGPTHGHEIRPSDGKAPKRTVYIQCVGSRDEKVGNPYCS
    RVCCMFALKNAQLMKMHDPNAEVYICYMDIRAFGKGYEEYYKRAQDQFGVKFIRGRPANIIEDPETKNLTVRVEDTLMGE
    ILEIDADLVVLSAGLEAKKDAGELAKMLGIDRGPEGFFKELHPKLAPVNTKVDGVAIAGVAQGPKDIPDTVAQAKGAASA
    VAIPMSQGQFKIEMIRATVNEEVCGGCKVCALMCPYNAITYEEKDGHLVAVTDDVACKGCGSCAAACPSGAMQLRYYRDE
    QVIGMIDGILNAAKMLEE

    >gi|134046799|ref|YP_001098284.1| redox-active disulfide protein 1 [Methanococcus maripaludis C5]
    MVKVEVFTSPMCPHCPAAKRVVDEVAKEIEGLEVVHINVMDHPEKAAELGIMAVPTVAINGEIKFVGAPTKDALLAELKK


    >gi|134046800|ref|YP_001098285.1| DsrE family protein [Methanococcus maripaludis C5]
    MIKEINVKSLRSPAMLVEKVIEKTDGGILVIETEGDSQINEISELIKKMGYKMEVDGTNVKVSIGEIEASKSINVVGASC
    PGPILMVGEVLERMAVGEVLEITAGPNAFTDLTEGLKSMGNDILSAEKTDDGNYKILIKKEEKKKELGVSVDIDEVFIIN
    MTGTGNAEKAYATFMMANVAQNMKLKPTIFLMFDGASLALKGECDKVKHPAFPKLGDKLRDAIKAGVKIYV
    CEMSSEFRG
    VDKKLEEGIEIAGAPTFFRFLSKPNARPVWL

    >gi|134046811|ref|YP_001098296.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus maripaludis C5]
    MIVTDIKKCRTYEECENCKNKEISKCMEVCPTNAIKMIDGKAFSCITCGTCAKECPTGAIKKNEYGGYYVNRKLCTGCGI
    CKNVCPIDIIDIREDSTGKAYPTGMCVM
    CGLCTTECPYDARLYFDPSSLKDTKNKMLMERYSTIFKMMGKTYEFPEPKHV
    KIVKPAERKVRTSISIDSEKCIECGKCIYLCPKDTIIESETVDGCTRCNICKEVCPVDAIDYGEVTEN
    CILCGNCISKCP
    KDVLEISEFKVVKTKEDVKAKPEKHCINCGLCVDLCPSNALRFENGKILYDPKTCTLCNTCVKECPQGVRINKGEFVNGG
    CVLCEVCIKECPEDAISIKERSKFTSIDKEE
    CIACGTCSMVCPNDAITVKIDSLNFSGNKVHSEVIFNDNCVMCEKCAIN
    CPRDVIENTSGHKKVVDRENSYIRTDSDYCVKCGLCTIICPNDAIDKGEINTEKCEYCSACVNICPTRAIRIYRTWNEKT
    K

    >gi|134045717|ref|YP_001097203.1| cytosine deaminase [Methanococcus maripaludis C5]
    MTDFIDEALKEAKLGLEEGGIPIGAVLVYKNEIIGRGHNRRVQNNSAILHAEMDALENAGRLTSDVYKNCELYTTLSPCI
    MCSGAVLLYKIKKVIIGENETFLGAENLLIKNGVDVEVLNDERCVKMMEDFIKNNPKLWNEDIGE