Methanococcus aeolicus Nankai 3 uid58823

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150400533|ref|YP_001324299.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus aeolicus Nankai-3]
    MEEPRIGVYVCHCGINIGGVVDCPELAKFAGELDNVTIARDYKYFCADPGQEIIKKDIKEYNLNRVVVAACSPRMHEPTF
    RRCVEEAGLNPFLFEFVNIREHDSWVHMHEPEKATEKAMDLVSMGVAKARLLEPLDFIEVDVTKRALVIGAGVSGIQAAL
    DLGDMGFETILVEKTPSVGGRMAQLDKTFPTNDCSI
    CILAPKMVDVAKHPNVKLYSYSEVNEIKGFIGNFTVDILKKARY
    LDEAKCTGCGQCAEVCPIEVPNEFDMGLGIRKAIYKPFPQAVPAKYTIDKEHCIGCELCSKVCGPGAINYSQEPEIIEEK
    VGTIITAIGYDAFDPTVKQEYGYGIYDNVLTGLELERLINASGPTMGHVLRLSDSKHPKRIAFIQCVGSRDAKTGNKYCS
    NVCCMYAMKNSQLIKEHEPDTKIDIYYMDIRAFSKGYEEFYERSARQYGINFIRGRPAQIIENPETKNLIIMSEDTLMGE
    ILEQEYDMVVLSVGMVPTESMDDVQKTLSISKSADGFFMEAHPKLKPVDTATDGIYLAGACQGPKDIPASVAQGSAAAAR
    AAIPMSKGRVNVEPIVAEVNEEICGVCGICVKQCPYGAPRLVEKDGTCSLEVLSALCKGCGTCIGGCPSGAMEQNHFKTN
    QLYNQIEGAFNITK

    >gi|150400731|ref|YP_001324497.1| heavy metal translocating P-type ATPase [Methanococcus aeolicus Nankai-3]
    MNVKIKISGMTCAVCAKTIEKVLSKTDGVNSITVNLVDESAEVDFNPDVISIEEIGKKIEKLGFDVVGIGEDENLEDVEE
    HKELELKDKLHRVIVGAVFSVVLFSMMYINIPYKPYLAFLLSLPPLIYVAMPIFKAGFNSLKTKSLNMDVMYSMGMGVAY
    LSAVMVTAGILPKEFMFYDTTIMLATLLTLGRYLEERAKGKTSEAIKKLMGLKPKTAKIIKDGKEVEVLIENVKIGDIIV
    VRPGEKIPVDAVVVEGESYVDESMITGEPVPNLKKSGDKVIGGTINTNGALRIKAEKVGKDTLLSQIIELVKNAQSSKPE
    IQGLADKVVSYFIPTVLIIALISATYWHFVNGFLFATTILISVLVVACPCALGLATPTAITVGIGRGAELGILIKDSRVF
    DVSDKLNAMIFDKTGTITIGEPEVMDIITDMDTNGFLKMVSILESNSEHPIANAIVKKALEQNLDISNKKVEKFRAISGK
    GVIGFVDGKEVVIGNKLFIEEYMGNNKNSNTDDKDNNKDNYNYENIAQKLENDGKTTLIVAVDEEIKGVIGISDKIKEDA
    KETIEALKNMGINTYMITGDNEKTAKIIGKNVGIVENNIFANVLPDEKAKIVEKIRNNVNGYVGFVGDGINDAPALSTAD
    VGVAIGGGTDIAIESGNVVLIKNRLKDVVGFVRLSKRILKQIKLNIFWAFAYNLALIPVAAGVLYPYGIVFRPELAAFAM
    TLSSITVVSLSLLLKRYNPYANEK

    >gi|150400737|ref|YP_001324503.1| heavy metal transport/detoxification protein [Methanococcus aeolicus Nankai-3]
    MKELKLKIEGMSCNMCVKTIKNLLSELDGIIEVDINLEDGIGIIKYDENKITENKILNNEAFELYSAEKI

    >gi|150400760|ref|YP_001324526.1| peroxiredoxin [Methanococcus aeolicus Nankai-3]
    MHEDICCIGEYKMPLIGEKFPEVEVKTTQGAIKLPEHFEGKWFVLFSHPADFTPVCTTEFVAFQNRYDQFKELNTELIGL
    SIDQVFSHLKWIEWIKDNLDVDIEFPVVADDRGQLAERLGMVSPYKGNNTVRAVFIVDDKGAIRAILYYPQEAGRNIDEI
    IRLVKALQTSDKGVALPANWPNNEIIGDKVIVPPASTVEEMKSRKEAAEKGEIECLDWWLCCKKLE

    >gi|150400763|ref|YP_001324529.1| glutaredoxin [Methanococcus aeolicus Nankai-3]
    MLVEVITSPQCPHCPTAKKVVEEVVKKVSCDDIEVKYIDVTEDPGTVEKYNIMTVPTIVINGEIAFLGAPSIEQLENYLR
    ENLSR

    >gi|150400770|ref|YP_001324536.1| heavy metal translocating P-type ATPase [Methanococcus aeolicus Nankai-3]
    MSKKLKLKGLDCANCAYKIENALKKEGFESASVNFATGELTIEGDIEKAKNIVKKVDSGVEVIEKEEHHHDCHDHGEDPK
    KMLYFIVPSLILFVIGVLLRYYYNYDNIFVFGIFVVGYMLVGWKVLRNAVVNSIHGNVFDENFLMTIATLGAFAIGEYPE
    AVGVMLFYMVGEFFQNLSINRSRKSIKGLLALKADYANLKIGDKTIKVKPEDVKVGDLILVKPGERVPLDGLVIEGSSTV
    DSSALTGESIPRVVKEGDELLSGILNLNGLLTVKVAKELKESTISRIFELVENASARKAKTERFITRFSRYYTPIVVGLA
    VLIATIPPLVFGEPLSNWVYRALVLLVISCPCALMLSIPLVYFGGIGKSAREGILVKGSNFLDALGKARIVAFDKTGTLT
    KGVFKTVQIVAKNSFNKDEILKFMALAEAHSSHPIANALKEAYGKEINENEIKEHEEIPGYGVRAKINGKEIMVGNDRLL
    HKFNIEHDTCHVKGTVVHVVVDGEYAGYIIISDEIKKDALETIQELRKLGVKKIVMLTGDSKDVAEEIAKKIGLDEFYAE
    LLPEDKVNIIEKLGAEKENGTVVFVGDGINDAPVIARSDLGVAMGALGSDVAIETADIVIMDDKPSKLPLGIKISKKVQN
    IVMENIILILIVKLSFVLLGALGQVTIWGAIFADVGVALLAVFNSMRILK

    >gi|150400805|ref|YP_001324571.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus aeolicus Nankai-3]
    MSSSLWYLYEFVRKKWISNFTCAKTDVESTIPQKRYRKIPVMVELPEKCISCGACAGACPCFAIEMVKNDEYNKELPVID
    DDS
    CITCALCVESCPTGVLDIGTVKEDTDGRAFSVPKYTNLIIDEELCVNCGLCKNACPVDAIDYNEKTHYIIDNDCIEC
    MECIKVCPVKDAIKTYDEKLLKEKFDKTQYLKYDRLTKLDNFNEDIEDGKNNNSDNNIDNNSNDNNNGDMDADTTADITM
    NNEDMPRIVKSLCIRCYNCVDVCPDGVDLDNYTVNTDSWEDICLAVCPTTAMRIGAVEKISKITDKCYIVNEDACIGCRI
    CYKVCGVDDTINISSETRMPYINPKLCVRCGLCYNECPVNAIDLTDTKIVENTCEVRKAKDEFRNVIRQDLDEFSKKYLA
    SKLEINKTMEKTINKSIT

    >gi|150400889|ref|YP_001324655.1| redox-active disulfide protein 2 [Methanococcus aeolicus Nankai-3]
    MKIRIFGTGCKKCTETYENVKKAVEELGIDAEVVKITDINEISEWIFVAPGVAFDDLVVFEGKLPTVEEVKKELEDYIK

    >gi|150400933|ref|YP_001324699.1| DsrE family protein [Methanococcus aeolicus Nankai-3]
    MIRKISVKCLRSPSILVDAVLSKMKDGILIVETDGENQIKDIENSIKKLGYKIEKEGNTIKILVGEIVANKTISVVGATC
    PGPIMMVSDILEKMETGELLEINAGKPALVDLTEGLKSMGHVVVSVEEQTDGTYKILIKKGEKKEEGATSVNIDEIFIIN
    TTGTGNAEKAYSTFMMADVALKMKLKPTIFLMLDGASMGQKGECDKVKHPAFPKLSELVKNALNNGIKIYV
    CELSAEFRG
    ISAKNLEDGFEIAGAPTFFNYLSKPTVRPVWL

    >gi|150400935|ref|YP_001324701.1| redox-active disulfide protein 1 [Methanococcus aeolicus Nankai-3]
    MVKIEVFTSPQCPHCPAAKRAVEEVLAEIKGDFEVEHVNVMEEPKRAADYGIMAVPTIVIDGEVAFMGAPQKEQLKEKLL
    SL

    >gi|150401020|ref|YP_001324786.1| thioredoxin domain-containing protein [Methanococcus aeolicus Nankai-3]
    MSKYIKLLILCSLSSMILFAGCVGTADGTNNNENHEISLNITDNTVMLEFYADWCGYCKALEPTIKDLENEGIEVIKIDT
    DKNQNLANQYGVRALPTIVYIKDGKIVDKTIGYKPEEIKEKAKKIYNN

    >gi|150401153|ref|YP_001324919.1| selenophosphate synthetase [Methanococcus aeolicus Nankai-3]
    MKSKDIKLTQMVELHGCACKLPNTELEALVKDIISKEDLEKTLVGLGDDAAVIIRNNLAIVKTVDVFTPIVDDPYTQGKI
    AACNSISDVYAMGVLDIIGVLVIMGIPQNLPIECAKEMLKGFQDFCRADDTTIIGGHTILNPAPIIGGSVSGVGRKEDIL
    TKGGAKEGDILILTKPLGTQSAMALSRVGEEYEDLLEITAKEKERIIDKAIELMTTSNRGALMALRELERENNEKIANAM
    TDITGFGILGHSQEMAEQSDVDIEINLLPIIKKTDYLSSSFGHQLLKGYGAETAGGLFISVNPNYADKLVEKLRISGNYA
    YMVGKVLKSKSDVGKAHLSDNLKILEIS

    >gi|150401176|ref|YP_001324942.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus aeolicus Nankai-3]
    MRTIIIGSGAAGLTTASTIRRYDKEMEITVITMDKYIAYSPCAIPYAICGEIPSFDDIIMHTPEEYKKNRLIDVITESEV
    LTVNSENNNITYKDSNGKINELSYDNLVIATGGSSFIPPIEGIDLEGVFKLRTIEDGMKIKEYAENSKSAVVAGAGAIGL
    EMAYALKVMGLDVVVIEMAPQVLPRALDIDMAETVKKYLEDIGIKFIIGKPLAKIIGEDKVRAIYADDREIDTDMIILAT
    GVRSNTELAKMAGCEVGRWAIKVNEKMETSIPNIYAVGDCVEVKDFITGQTTLSPFGTTAVRQGKVAGKNIVGIEAKFNP
    VLNAMVSKIGDIEMAGTGMSELGAHQNRLKVVVGKSKALTRARYYPDGKLIEVKLICDNNKHIVGCQIVGGERVAERVDA
    ISIAIVNHMTCKELADMEFCYAPPVSMVIDPLALAAENACDKFKKIKKE

    >gi|150401195|ref|YP_001324961.1| thioredoxin reductase [Methanococcus aeolicus Nankai-3]
    MVYDLIIIGAGPAGLTAGIYGMRAKLNMACIEKENEGGKIAEAGAVENYPGFENIKGYELAQNFSNHAKKFGLNIIHDNI
    QNIDTTARPFKIMGDNETYKANAIILATGTKDKKLGLNEDEFVGKGVSY
    CATCDAFFYVGKEVIVVGKGTPAVMSALNLK
    DIVKKVILITEEPEIKAAEPIMLERLNNSENIELITNAKPLKIIGENKVEGLLISLNGDEKEIKSEGIFITMGHIPNSEY
    LKDSGIELTKRGFVKVDKNCKTNIEGIFACGDIAGGILQVSKAVGEGAVALASASRYLDKLDSK

    >gi|150401256|ref|YP_001325022.1| transporter component [Methanococcus aeolicus Nankai-3]
    MYIHAIGTLLFGIVLGYLFQRSRMCFAGGMRDFYLVKDSYLLKGLFGTIAGAFIGYAIFSAMGLISAFPWALSKGLLVPI
    PGDPIGASGSVMGHIILACIGGFGVGFLSIIQGG
    CPLRNYVMAAEGNKTAITYVLGLAVGAVIFHLWVAPFVKSLGL

    >gi|150401284|ref|YP_001325050.1| DsrE family protein [Methanococcus aeolicus Nankai-3]
    MKFTVIITLAPYGQEKAYSALRFALTSILEGIDINIFLLEDGIYVAKTNQNPAGAPNYLEYLQNCIEAGAVVKVCGPCCK
    ARGLEEKDLIDGVKLATMHDLVAFTKESDKVITF

    >gi|150401388|ref|YP_001325154.1| DsrE family protein [Methanococcus aeolicus Nankai-3]
    MKTLTIILKSGAMMNMDGNFAVKLAESALKKGHKVNMFFYGEGITAIIDKQAPKRFPNLGTTIKELMDKGMVVAACSTCA
    NARGIYEENVIEGCKIGSLTNDLSKYIADSDRVITLTR

    >gi|150401390|ref|YP_001325156.1| pyridine nucleotide-disulphide oxidoreductase family protein [Methanococcus aeolicus Nankai-3]
    MADKMALVVSEGTFDKAMMAFILGTIGASMGMEVHIFFTFFGLEVLKKNAKPKLPGIYRLFGSLGVKMMEKKMKKQNIGG
    FEESRQQTIDLGAKLYA
    CSTSMSIMGVKEEDLIDGVEIVGATKFIDLAMDAKVQLFIG

    >gi|150401511|ref|YP_001325277.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus aeolicus Nankai-3]
    MELQNFSEKNFYSRKNSKAILRPPENTKNIENTKIAVIGGGPAGKYCSTELAKKGFSVSIYEKNKIGGTCLNYGCTYVTG
    LREMADIINNLNIVNSNKEIKDNTKLEDVISFKELQKNISNILTKIRGKLEGDLLKYNNIKLYNEEFKEEYKKNYDYIVY
    ATGKEYTNNYNGVECLIHSDIVNLEELPEKILIVGGGTVAMEYASLFSNYGCEVVVYVRSKFLKMIEDKDIRDYILKFIT
    FKIINDENQLNELLNDSSYTKILAIGGKATIKTDDNLKVIGKDNEYACGDCVIGKGGTTPISRMEGKVVAENIYNELNNK
    PPIKPNYNNIPNTIRLDLNISYVGKQTDDFKIIPNSVGKGDFFRVFNHIGINKIYYENNRVVGAISMSPSMETIPYFAQY
    LNGVNIYDGFIEVHPSTDPFYKIFGSR

    >gi|150401635|ref|YP_001325401.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Methanococcus aeolicus Nankai-3]
    MSNLKVGVFVCYCGSNINGVVDCEAVKEYASTLDDVVYTATYPFFCADPGQNMIKDAIKEHGLDRVVVAACTPKIHEPTF
    RTCLSDAGISPYYLEFVNIREQDSFVHMADSEAATKKAMELVAGGVERAKNLEDIPQKTVEVDKSCLVIGAGIAGIQSAL
    DLADQGFKVYLVDQDESIGGRMAQLAKTFPTDDCSL
    CILAPKMVTVANHPNVEVITYAEVTNVDGYIGNFDITIKKKPRY
    VSESACTGCGACAAVCPIEVPNEFDCGLGMRKAIYAPFPQAVPLVYTIDKEHCIDCKLCDKACGPDAIDYNQQPEEIKFK
    VGTIITTTGYDEFDASLKEEYGYGVYDNVITTLEIERMINPAGPTGGHEIRPSDGKAPKKTVYIQCVGSRDAKVGNPYCS
    RICCMFSLKNAQLMKMHDPDSEVYICYMDIRAYGKGYEEYYQRAQEQFGVRFIRGRPAQIIEDPETKNLKVLVEDTLLGE
    VLEIDADLVVLSAGLVPKPDTKRLAKLMGLDVGPEGFLKEFHPKLAPVNTKVEGIAIAGLAQGPKDIPDTVAQAKGAASA
    VAIPMSQGQVNIEMIRVVVNEDVCGACGICAPLCPYNAIKYENDLAVVDDIACKGCGSCAGACPSGAMQLRYYRDEQILS
    NIDGMLDTHKCFEQK

    >gi|150400739|ref|YP_001324505.1| ferredoxin-thioredoxin reductase catalytic subunit-like protein [Methanococcus aeolicus Nankai-3]
    MANNLLKLYVNSTCPLCNILKNILEYNNIKFELINIEDIEESDLNEEFKVFNNIGDIKNIAFPSIVLGNEIIVGYNIEKL
    EKLLNKKLLKPPVTEKSFIDFAKHNKHNNDSNDKNNLIEYYNKVELFSEYSGYYLNPDKDYVLNVLNTQLKNQENGIKYC
    PCKLGNVPCPCPDVKHEIKTYGHCFCGLYVSNEYIENWKKMDTPLMLSNRNIKKYEDIPNNINSHFLKIHILFNKGMIEG
    NSKSSDLIIEELLDKTYRLKNSGYGIKNDILIKFKEDEAHKNLQLWYNDFNDYYNNKNKVGDIFSDYEFDIAINVPIEVP
    DGEKIEYNGLTITTNYNTTQYRRRYLIEGNNLNIINGIDNIIVLEVVGQMNEIMNDLYLEYSKKVESLQQDINQLVIDVN
    IDKEHSFEEYLSMLSISVKNISNLQEKLTKKYSLFEYYMAKKLDDQKFKSFLDSAGYSMEYRELLNDFTHLLNELSIMKN
    TVNELIGILETNVNISQNNKTINLQNEIHKTAKTQLNMHRAVEGLYTIFAAFYFTELALIVFEGLNHAHIVKYDAYVLAS
    FFVPVAMLLGVVVSKKLKNKYG