Methanococcoides burtonii DSM 6242 uid58023

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|91772156|ref|YP_564848.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methanococcoides burtonii DSM 6242]
    MAKTSLSAGEKAPNLCLPDSEGNDVTLNDLKGKWVVLYFYPRDNTSGCSIEAMEFTKLKDDFEKEGAFILGVSKDSQASH
    KKFIEKKELGITLLSDEGTELQQSYDVWHQKKMAGKEYMGTVRTTFLIDPEGNLAKVWDKVKAKGHAMEVLDELKMIKAE


    >gi|91772177|ref|YP_564869.1| thioredoxin reductase [Methanococcoides burtonii DSM 6242]
    MVYDLIIIGGGPGGLSAGIYAVRYGLNTLVLEKGFVSGQISTTGDVENYPGFPSIGGMELMDKFAEHAKAAGVVVEDRDV
    LEVRSEGDMKIVHTSEGDIEASSVIIATGAEPKHLGIPGEEEFRGKGVSY
    CATCDGPFFSGRNVIVVGGGESAITDALIL
    SDMAASVCVVHRRDELRASKILQDRAFARSNIEFLWGTTLEEIVGDSVVREAVIRDINAAEVCRVPIDGVFVYVGVKPST
    GFVDVDKDKYGFIITNERMECSEKGVFAVGDCRNAILRQVVTAASDGAIAAFEAYNYVSSLERSGK

    >gi|91772178|ref|YP_564870.1| hypothetical protein Mbur_0102 [Methanococcoides burtonii DSM 6242]
    MTKVILVHASWCHVCPAAKKLWQSLKEGHDFDYDEVDFDTPEGEKLAEEYSIMSVPTTIIDGKVAFVGVPNKEKAVSMLS


    >gi|91772295|ref|YP_564987.1| thioredoxin-related [Methanococcoides burtonii DSM 6242]
    MQNNYVGEVGDGNWEIMVEKQPKPVLVMFYLNTCSHCKAIDPYFREFAETYKDSCKFFRLNAELNPWVAERYGVEGTPTF
    IFTCAGKMIRGMAGVSHPSELKKNIEDFLKDGSVCAANITSLKYDMSLYG

    >gi|91772326|ref|YP_565018.1| alkylhydroperoxidase family protein [Methanococcoides burtonii DSM 6242]
    MSKHEELEHKELLDSMSDKLGFTPRILETVGDLDPDFLKKYNRCNHKLLSDGTLPAKMKILMALAVVASKQCDRCTVVQM
    QSALKNGATKEEIMETMEVIYITSGAPAVASCREALKQLK

    >gi|91772329|ref|YP_565021.1| redox-active disulfide protein 2 [Methanococcoides burtonii DSM 6242]
    MKIEILGTGCAKCIKAKEIVEKALQESGLQAEVVKVEDYETILSYGVMITPGLVIDGEAMIAGRVPSVDNVKK

    >gi|91772388|ref|YP_565080.1| thioredoxin-related protein [Methanococcoides burtonii DSM 6242]
    MGLESFIGSVFGRSNQGEVTGPVIVELNTNLFLINTFAFEAEVEHSNLPVVVDCFTKTCPPCKKMGQVFEKVASEYESKV
    KFIKIDLKASPAIGKRFNILGVPTLLFFKDGNLQNNVVGFTNEDKFREHLDNLLEQLSGNSPSEVINMTDNESTKEDMHA
    WTAKYADKAGYMLNPDEESLHLVLEGLARNRNKHGKNYCPCRIVTGDEQEDKKIICPCIYHKDEINDGGSCHCDLFFKKK
    D

    >gi|91772578|ref|YP_565270.1| hypothetical protein Mbur_0543 [Methanococcoides burtonii DSM 6242]
    MTNNDKGTKNRLINEKNPYLLQHANDSVDWYPWTEEAFEKAKNEDKPIFLSIGYSTCHWCHVMAKESFRNKDVAKMMNDT
    FVSIKVDREERPDIDSVYMDICQKMNGSGGWPLTIIMTPEKVPFIAATYIPLKSGFGRKGMLEIIPWIEHLWKEEHNKIV
    EQTELIKTALSEKSENSHNEEVTEEIIHRTYTYLANNFDNENGGFGTSPKFPSPHNISYLLRYWKRTGNPTALQMVERTL
    QAMRKGGIYDHIGFGFHRYSTDSSWLVPHFEKMLYDQALLIIAYTEAYQATNKEEYSNTANEIIEYILRDMTSPDGGFYC
    AGDADSEEVEGRFYTWELSEIESILNREDHPIFRDAFNVRPEGNFLEESTHRPNGKNILHLEKDLESIEKQYNITRKEID
    HIIERCRKQLFSTREKRIHPSKDDKILTDWNGLMLAALSISGRVMGNKRYIDIAKRNADLLISERMKENGELYHNYSSNK
    EPTIGFLDDYAFFTWGLIELYEATFEVTYLAKALQLTDYMIENFKDTINGGFFHTSNKSETLLFRKKEVYDGAIPSGNSV
    EINNLLKLSKLTGNPELNSEAIDTSNAFASTIYAMPFGYTHFIAGLDLALAPSVEIVIAGELDSEDTQLMLNNINEEFIP
    GKTVIVKSEKNEKELERIAPYTSTLKTQNQKATAYVCQGHECTLPTTDPQIIVEILKKIHNIQ

    >gi|91772585|ref|YP_565277.1| CoB--CoM heterodisulfide reductase subunit A [Methanococcoides burtonii DSM 6242]
    MRIGVYICHCGLNIASVINMDALHEKVEQMKGVELVKDIQFMCSDVGQDALMDDIEEHDIDRVLVAACTPKLHENTFKKV
    LERAGLNTYLLEIVNIREQCSWVHMDHHDMATQKAFDLIKMGVAKLSLLEPLRIRKIKANKDVLVIGGGVAGIEAALTLA
    DSGTHVYMVEKEPTIGGKMALLNEVFPTNDCSI
    CVLAPKMTDVQNHTNIDLFTYSEIKDISGSVGNFTVKGIQNPRYVII
    DNCKGCIDECARVCPVDISNPFDSGLGKTKAINMPIPQAIPQTAFINSDYCVGCGLCKQACPADAIDFNMKAEEFTFTVG
    AVIVATGYQGFDAKRKEEYGYGVFPDVLTNMELERLLNASGPTRGKVVVPSTKETPKKVAFIQCVGSRDETVGNPYCSRV
    CCMSSMKNAQMIKERYPDTEVTIHYIDIRAAGEMYEEYYVRSQMMGIDFIRGKVAEIQIDTQGKMLLRYEDTLECTLCQE
    NYDLVVLATGMEPSNTTEPIARTLNLTKRTDRFLSIAHPKMRPVDAHINGVFIAGCASGPKEIQVSIAQGSASAARSTRL
    LARGELENDPFSACVDAEKCIGCRMCEDTCNFNTIKVIDGKAVVDEISCQTCGSCSASCPVDAIDMPHSTDAQIKAQIRA
    ALEVKDEFPLIIAFLCNW
    CSYASADLAGTSRIQYPTNVRIIKVMCAGRVDPDFVLEALQGGADGVIVAGCRLDECHYIIG
    NYDAKHRMDNLKEVLEEIGLDQRRLRVEWISAAEGERFAKTIEDYVDELTELGPVGSELQGGDPDE

    >gi|91772641|ref|YP_565333.1| copper-translocating P-type ATPase [Methanococcoides burtonii DSM 6242]
    MEAKIDVLGMTCMHCHERVTKAISALKGVESVDVSLEENNATVIFDPEKVSLEEIEQAILGLGYEVGKDDNSGIPDDLTE
    DTETIEVGDTVDAEGKSNSHPTPVELLQENGEKVTQKADKEPVETTLKVTGMT
    CAACAIRIEDALKKQSGVLSVTVNLPL
    EKASVTYDPQLFTTEKLEKTVEDTGYGILKDEMAFDVGGMT
    CAACATNIERALKKLDGVSDASVNFPMSTARAKYDPDKV
    SAADMLKAIEEIGYTASVKKEGSPLDRERAARDTEMTHQKNNLIIAVLLTIPIALGGMSAGFPQYLYFVPPILADRMVLF
    ILTTIVMAFPGRQYFVGAYKGLRHSSADMNLLIATGTGAAYTISVVTSFIDLGPGYQHTFFETAAMLITFITFGRYLEAK
    ARGRTSEAIRKLIGLQARTARVIRNDEEVEVAVEDVVAGDIVVVRPGEKLPVDGIVVEGTSSIDESMISGESIPVEKNAG
    DTVIGATVNATGSFKFKATKVGADTALAQIIKLVEDAQTSKAPIQRVADFVAGRFIVTVIAIAVISFMFWFFIGYGLYDV
    AQYSVISSPFLFSLLIGITVLVISCPCAVGLATPVAIMVGTGKGAENGILIKGGEALEVTRKIGTIVFDKTGTLTEGKPV
    LTDVITFGDHSRDEVLSLAATAEKGSEHPLGEAIVNGAVDSNVDILDTTAFDSIPGHGVTATIDGRKVLLGTRKLMADNN
    VDVSGMTDALEELELQGKTAMLVSADGNAIGIVAVADTLKRNSVQAVSKLKSMGIEVVMMTGDNSRTASAIASEAGIDRV
    LSEVLPEDKAAEVKKLQKENKIVAMVGDGINDAPALTQADVGIAMGAGTDVAMESAQIVLIRNDLLDVVASLKLSRLTMR
    KIKQNLFWAFGYNSLGIPIAAGILYPVFHQVLVTPAMAAAFMAMSSVSVVTNSLLMKRSRIK

    >gi|91772659|ref|YP_565351.1| alkylhydroperoxidase-like protein [Methanococcoides burtonii DSM 6242]
    MTFLDDKMPEAAKAFGDLRSAIFRANALDIKTKELIAVASAVLMRCEKCVKIHSERAKQNGATEEEIAESIAIATFIAAG
    SQLHWTNAYDEILDGTDE

    >gi|91772943|ref|YP_565635.1| redox-active disulfide protein 2 [Methanococcoides burtonii DSM 6242]
    MKIEILGSGCAKCNKLKELVEKVVNENSINAEITKVEDINKILEYGVMITPGLVIDGDVKIAGKIPSEDKVREWLTQ

    >gi|91772959|ref|YP_565651.1| peroxiredoxin [Methanococcoides burtonii DSM 6242]
    MSETENTERITMPLIGDIAPTFKVDTTMGEISFPEDYKGKWVILFSHPADFTPVCTTEFMTFASMQEDFRELNTELIGLS
    IDSKYAHIAWLRTIKEKIEYKGMKNVEVLFPVIADIKMEVAKMFGMVQPNASDNQAVRAVFIMDPEAKVRAILYYPLSNG
    RNMDEIKRMIIAMQKSDKENIATPANWNPGDDVIIPPPGSCGAAKERVESEEEGKYCLDWFMCLRKDS

    >gi|91773353|ref|YP_566045.1| electron transport complex, RnfABCDGE type, A subunit [Methanococcoides burtonii DSM 6242]
    MAADVSLFQIFMDGVFIKNFLIIQFLGLCSFVGVTKDTKSAAGMSGAVIFVMTLAATVSFLIYNFVLVPLKLEFLDLISF
    IVVIAALVQLVEFVVRKNVPSLYRSLGIYLPLITTN
    CAVLGVVLLNVLNEYSFIQSVVFGVSAGIGYALVMLMMSGIRER
    TTLVNVPSSMRGLPHAFLIATMLSMAFVNYFGVIPL

    >gi|91773354|ref|YP_566046.1| SoxR-reducing system protein RsxE [Methanococcoides burtonii DSM 6242]
    MDPLSEFIRGITKDNPIFGLVLGLCPTLAVTTSIDNAIGMSAGTAFVLICSNLMVSGLRKQIPASVRLPIFILIIATFVS
    IVKMVMEAYFPPMYAALGVFIPLIVVN
    CIIIGRAEAYANKNNMFYSLIDALGSSAGFLLVLVLIGGIRELLGTGGIAIFG
    TQLVSIPINPITFMILSPGAFLTIGILMAIVNHRRAKKLARGG

    >gi|91773522|ref|YP_566214.1| rhodanese-like protein [Methanococcoides burtonii DSM 6242]
    MSILSNNITMLVILLVIACIALGFIGYDKFAPNQNGTDVSYTDVSVHEAKDIFDKGDVFLLDVRTESEFNSGHLEGAVNI
    EVSQLGTRLNEAPADKVILVY
    CRTGVRSVRASKTLVNAGYTDVYNMKGGIMAWMSAGYPYVS

    >gi|91773622|ref|YP_566314.1| thioredoxin [Methanococcoides burtonii DSM 6242]
    MDDLEKIRQQRLEQIKKGLEAKAFPDAPIHVTDADFNEFIAKYPITVIDCWAEWCGPCRKLIPIIDALAKEYQGKIVFGK
    LNTDENQMVARNFNITAIPTILVFKNGNAATQIVGALQKEQLVEHLNKFIQ

    >gi|91773715|ref|YP_566407.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcoides burtonii DSM 6242]
    MKDNRKYDLAIIGGGAAGLATATHVKRCSDLSVIVISKDSHISYSECGIPFKLAGKVHDFDSLIVKTPEFFDKMGIDIAL
    ETEALSIDILNRTIKLENYDILFDKLIIATGGKQRIPQPLQKYIGMDGVFTLQTLADGMKIETALLSAETVVIIGAGAIG
    VEIAAGIAKRGIDTTLINRGPAILSRLIDPDMAEIVSEYLKSVGVTLVTGNVPDTIEGKEGVESVLISGERIPADIVIIS
    TGILPDVELAEKAGISTGELGGIIVNQHLQVFVDGNFSTDIFAGGDCCEITDFITNKKTLVQLAPAARHMATIMANNVCG
    KDTVLKPLLGPSIYVAGDLLIGSVGLTSKRARAEDIYIITGYATGTTKASYYPGSSDIHIKLIFSDDRLTGAQIIGKSGV
    KERIDSLAFMIKKKATIEEMLSIETCYAPPVSTVVDPLMYAVKDAFRKIKART

    >gi|91773730|ref|YP_566422.1| dihydrolipoamide dehydrogenase [Methanococcoides burtonii DSM 6242]
    MKEYDLIVIGSGSGMNYVSLIIQQYPEMKIAVIDKDKPGGICLTRGCIPSKMLLYPAELVREIGKANRFGIDAEIKSIDF
    KFVMERMRSSIDKDIEMIHHGLSSDPNLDYYEHVAKFVEPYVLEIGEELITSKMIFLSIGSKPMIPPVKGLDDISYLTSD
    TVLELTTLPKSLAIIGGGYIAAEYGHFFSAMGSKVTIIGRSPRIVDNEEPEISELARKKMARYVDIITDHEVSEIHPSGR
    QKKIVAKDRNSENEMEILVDEVLVATGRSPNTDILHPEKGGIETDERGWIKVNDHLETTCSNVWAFGDANGQYLFKHVGN
    YESTLVYENAILNEGIKIDYNAVPYAIFSYPEIAGVGIGESAAIEQYGEDNISIGFHRFEDTGKGMAMGLDSYFVKVILG
    DSGNTLLGAHIIGPQASILIHQLITLMNTPGSNVGPVVNGMDIHPSLSEVVKRALYSRMSVEEYHSVLKSLELEY

    >gi|91773733|ref|YP_566425.1| HesB/YadR/YfhF [Methanococcoides burtonii DSM 6242]
    MIEITDIAATELKALLETEEKKDHALRIFVAGMGCSGVQYGMALDDEIKEDDITVTSKDIKIVIGPDISEQLEEATVDYI
    DTDGGKGFIIDNPSVNSGCGSCGGSCH

    >gi|91773792|ref|YP_566484.1| thioredoxin-related [Methanococcoides burtonii DSM 6242]
    MSNVVIMDFTATWCGPCQIQKPILEQLEGELGDKVEFKMVDVDQNNALAGKYGVSAVPTLIIEKDGEVVKRYTGVTSADV
    LRAELNTLI

    >gi|91773849|ref|YP_566541.1| alkylhydroperoxidase-like protein [Methanococcoides burtonii DSM 6242]
    MDIEKIREIIDKEPDEAVSDILEGVKERYGEIPYILEFMRDMPDLLLPKVMYDNSIMREFERLDPKTIELICIGVSSALR
    CDH
    CMNMHIRVANRLGLSKEEIFDAVLIAGAISNASVLAEGTRALDTEFNGKKCDGNDECDVCKIANHD

    >gi|91774055|ref|YP_566747.1| glutaredoxin-like protein [Methanococcoides burtonii DSM 6242]
    MSDIIIYTTETCPKCVQLKKVLKSNDVIFTEADMSTPESLTELRLNGVFTVTAPVLQIDDDFLTYEELFNSDGVNLGSLK
    SIL

    >gi|91774142|ref|YP_566834.1| methylated-DNA--protein-cysteine methyltransferase [Methanococcoides burtonii DSM 6242]
    MYYDTMQTDLVGEILLVGDTDELKMVALQQGKKRLSISSEWTHDGSLFSNAKEQLQQYFNGDLKDFDLELLPDGTDFQKK
    VWSALRNIQFGTTVSYSDIAKAIGNPKAVRAVGSAIGANPISTIIP
    CHRVVSSSGKLTGFSSGIDLKILLLEHEGLKVKG
    NGKDAIVD

    >gi|91774240|ref|YP_566932.1| peptide methionine sulfoxide reductase [Methanococcoides burtonii DSM 6242]
    MERATFAAGCFWGVEAAFSKVEGVISTKVGYTGGTLKDPTYKDVSTGSTGHAESIDIIFDESVITYGELLEVLWNTHDPT
    TKDSQGPDHGSQYRSAIFYHDDAQREAALRSREQLERSGKYDSTIKTEIVKASEFSPAEDYHQKYFQKLQFKR

    >gi|91774241|ref|YP_566933.1| methionine sulfoxide reductase B [Methanococcoides burtonii DSM 6242]
    MKQKINRSEEEWKKLLTPEQYAILREKKTEIPFTGELLRNDRPGVYSCGACGQEIFSSKNKFDSSSGWPSFYEVISNDRV
    ELVIDDSYFMKRIEIQCSNCGSHLGHVFDDGPQSTGKRY
    CINSASLGFTEGSEKEKEKKNDK

    >gi|91774265|ref|YP_566957.1| thioredoxin [Methanococcoides burtonii DSM 6242]
    MKLEALVITLLTLSVLLAGCVSDVTPIDAEYDANDRDAILVTEKQQIDDALVNGPVLLKIGAEWCPPCTQLDPVLDELAM
    DYEGRATIMYIDSGITSGLAAQFKYYSIPDTTVIAGIEDGSYLFMRRDGVIDTSRNKARILGYVDISVLETVLDHAIEYH
    ANTSE

    >gi|91774285|ref|YP_566977.1| alkylhydroperoxidase-like protein [Methanococcoides burtonii DSM 6242]
    MSEESRKIIDDIGDKMGFTPQILETLHELDPHFVKKYTRCDHKILTDGALPAKVKILMALAVVASKQCESCTVAQMKSAL
    KNGATKEEIMETMEVISVTSGAPAVAACRDALKMLK