Methanocella paludicola SANAE uid42887

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|282162709|ref|YP_003355094.1| thioredoxin [Methanocella paludicola SANAE]
    MAETTQFVKEVNDAGFDEAVKSNRVALVDCWAPWCGPCRILAPTIEALAKDYGDKVKFFKLNTDENPRVTTQFRIRSIPT
    LFIFVDGKLADTIIGAVPRQYIEGKLKALLPQ

    >gi|282162740|ref|YP_003355125.1| peroxiredoxin [Methanocella paludicola SANAE]
    MLRINEKAPDFEAEAYQNDRIKKIKFSDYHGKWMVLVFYPGDFTFVCPTELQELGELYDDFKKEGAQVLSVSKDTVFVHK
    AWHDNSPAISKIQYPMVADPSGKICREFGTLIEDEGLSLRGSFVIDPDGFLKCMEIQDNNIGRSMRELLRKLQAAKFVRE
    HKGRACPASWEPGEETLKPGLDLVGKI

    >gi|282162771|ref|YP_003355156.1| hypothetical protein MCP_0101 [Methanocella paludicola SANAE]
    MKVTDKAAEQLKTLLDKEQKKDSLIRIYFAGYSCSGPQYAPALDMEKKEEDVVTNMNGINVVYDRNLEKDLELFELDYIQ
    TPYGEGFIVRNPSASCGSDCSGCH

    >gi|282163053|ref|YP_003355438.1| hypothetical protein MCP_0383 [Methanocella paludicola SANAE]
    MNRLAGESSSYLKNAAGQPVDWYPWNDEAFEKARIEEKPVLLSIGAVWCHWCHVMAHESWEDPETACMVNELFVPVKVDL
    DERPDLDKTYQEAVGMLTGQGGWPLTVFLTPDKEPFYGGTYFPKAPIRGMPAFKEVMQAVSKAYKEQRGAIRQTAEQLKA
    LMAKVPAKKEAIDEDMPGLVTGNIISSFDTANGGFGRSMKFPYSEILLFLMQQYGSSRDAGVWHVVDKTLRYMAAGGFYD
    QVGGGFHRYAVDPAWKVPHFEKMLNDNAMLLRVYLNAYRLSGAAYFKQVALETTDFVFRRMAREPAGFVSSVDADLHGEE
    GSYFTWTEAEIREVLGDGADAFIKAYHVEQDGNFEVPGKNVLFVPGEHDKSRFAAEKRKLLEARHGRELPFIDMAVHASW
    TALMAGSLAVAYDVLGDRRCLDYAKKTLDFMMDPMYRDGTLYRIYTDSPSVDGFLDDYSCTVEALIDVFRASQEPLYLDM
    AIRLAADCDAKFYDREHGGYFYVQEKDRTPMSMDKPIVDLSVPASNPQMALSLMKLHYYTGERGYLDRAKELLEIFTAEA
    SMHPIGCGTYFSALDYYLQRPLEAVVVAGRDEGQNLVRLINSRVDKAVVLMDYGQERRLPAFEGKSTLDGKPTVYFCREG
    TCEAPMNDLKNIEAYLSRP

    >gi|282163054|ref|YP_003355439.1| copper-transporting P-type ATPase [Methanocella paludicola SANAE]
    MVIAEAPEKKTLLKITGMTCASCVKRVEDALREQKGVTEANVNLANEKATVTYDPSQVSVENMVSAVKDAGYGVMVETVT
    LPVQGMT
    CASCVKRIEDALRGKDGVIDVAVNLATERVTIKYSPTEVTLPELKKTITDAGYTVIETKTEKEFVDTERSARQ
    KEMRDLTLSFILSGIASAVIMILMFFGSSLPVVKTWPMEWITYISFILATPVQFIIGWRFYRGAWAALKHGTADMNVLIA
    VGTSAAYFYSVVATFVPHLVMVGGRMPDTYYDTSTMIIALILLGRLLEARAKGQTSEAIRRLTGLRAKTARVIRDHTEED
    IPVEDVKVGDAILVRPGEKIPVDGVVTEGYSSVDESMITGEPIPSSKKEGDNVMGATINKTGSFRFKATKVGRDTVLSQI
    IKMVEEAQGTKAPIQRLADQVAAVFVPVVIGLAILTFLAWYFIGGEPLFALLNFISVLIIACPCAMGLATPTAIMVGTGK
    GAQYGILIKGGESLENAYRIDTIVLDKTGTITKGEPSLVDVVPMAGFTEADVIRYAASAEKGSEHPLGEAIVKGAKAGNI
    PLTGATKFDAVPGKGIVAEVDGHIVMAGNAKLMELEEVPLEEMQKAFERLSAEGKTPMYVSVDEKPAGVVAVADTIKEGS
    MEAIAEFRRLGIEAIMVTGDNRRTAEAIARQVGIDRVMAEVLPQDKAEVIKSLQAEKKNVAMVGDGINDAPALAQADTGI
    AIGTGTDVAIESSDITLMRGDLRSVVTAIRLSKATIRTIRMNLFWAFFYNVIGIPIAAGILYPWFHILLNPIIAAAAMAF
    SSVSVVSNSLLLNRFKP

    >gi|282163131|ref|YP_003355516.1| peroxiredoxin [Methanocella paludicola SANAE]
    MVNKGNGQQAHGLKINERLPALEADAYYKNNITRINLSDYQGKWLVFIFYPADFTFVCPTELEEMASLYKNFTEQGAEVF
    SVSRDTPYVHKAWHDSDPRINKVEYPMLSDTTGELCKAFGTYNESNGLSQRASFIFDPDGNLKAMEIHDDGFGRNTRELL
    RELEALKFVRENKGKVCPAGWKPGDEAIQP

    >gi|282163284|ref|YP_003355669.1| peptide methionine sulfoxide reductase MsrB [Methanocella paludicola SANAE]
    MTQVSKPPKEELKKKLTPMQYKVTQEQGTEPPFQNEFWNEHREGLYVDIVTGEPLFTSKDKFDSGCGWPSFTKPMEKGKV
    EEKIDTSHGMVRTEVRGKGSDSHLGHVFNDGPGPSGLRY
    CINSAALRFIPKEDLEKEGYGEYRKLFE

    >gi|282163289|ref|YP_003355674.1| putative glutaredoxin [Methanocella paludicola SANAE]
    MKKIKIYSQPTCPDCNRVKAYLDKKGVSYEDINVRKDKKAMDEMVKRYGIRVTPVVVIGDRVMVGFNVPKIDKFLGAQD

    >gi|282163290|ref|YP_003355675.1| putative thioredoxin reductase [Methanocella paludicola SANAE]
    MMALLDLIIIGAGPAGMTAAIYAKRKGLTLQVLADSVGGQVTKTGNVENYPGYKSIPGPQLAALIKKQLEEMTVDITMSR
    AAKLEKSGDYFKVTSGDGHTYEARAVIIASGSKWKELNVPGEKEFKNRGVSY
    CPTCDGPLFSGMDVAVIGGGNAAAEAVL
    DLIPLATKVYLVVRSTLKADKVVIDKISANDKVTILTGYTVDKINGTDFVESVDIVSTGGERKTLSVGGVFVEVGLAPNV
    AFAKDLVQLNDRGEIVIDERCRTSVCGVYAAGDVSDVPQKQIIVAAGEGAKAAMSAFTYISTQKC

    >gi|282163303|ref|YP_003355688.1| peroxiredoxin [Methanocella paludicola SANAE]
    MHDEVSVISPQGILSIGMPAPDFEAVTTHGKIKLSQYKGKWVVLFSHPSDFTPVCTTEFIAFAERYEDFKKRNVEIIGLS
    IDSVYSHIAWARSIQEKTGCRIPFPIIADLDMRVAKAFNMIHPAMSETSAVRAVFFIDPNRILRAMVYYPQTTGRNMDEL
    LRIVDSLQIVDKEKVATPANWRPGDAVIVPAPNTQEGAEKRLNEGYECMDWYLCKKKL

    >gi|282163313|ref|YP_003355698.1| putative peroxiredoxin [Methanocella paludicola SANAE]
    MYRSMLGNVRQGSKAPMFSALDVRGDMFDTRAYLGRSNLVLFFYRGYWCATCREELLGLKGEYQRISTQDSEVVAISKDS
    IDEAKNMAVNLQLPYKVISDPDHHIIDMYDVYDSENETAFITLFLIDKAGVVRYKRSIAGLEDVMPATEIVNKLKNLGSA
    F

    >gi|282163346|ref|YP_003355731.1| hypothetical protein MCP_0676 [Methanocella paludicola SANAE]
    MKVQIYGTGCAKCNMLEKAAKQAIKEMGVNAEVVKVNDINQIVEAGILATPGFAVEGEVKSMGRVPSNDEIKKWIKAKM

    >gi|282163350|ref|YP_003355735.1| putative thioredoxin reductase [Methanocella paludicola SANAE]
    MSDKIYDIAIIGAGPAGLTSALYCGRANLSTIVFGNVYESQIAKAGDIRNYPGIDSIQGVDLIEKFEIQAEHYNITHVPS
    NVTRAILGELFTLYSELDEFKCRSIIVATGSKHRELNIPGEKELAYKGVSY
    CSICDGNLYKGKVVALVGSGDQAAKAALY
    LAGLCKEVLVLTDKSDMDSPQYMEQVKSNTAIRVMGNARVVAIEGHEAVERIGFRINEGPEEVAGVEAVFIEGGIPNTLL
    ALELGLELDDKGNISVSRPDQSTNVSGVFAAGDVTSGIHQVSKAVGDGASAAMSAILYVKKQKKGDSKLT

    >gi|282163359|ref|YP_003355744.1| putative methyltransferase [Methanocella paludicola SANAE]
    MSSKIDELSVRKAVKERYSGLATSGSSGKDYASRIGYSGEAVEKLPDQVLEVSAGCGNPTAIADLKPGQTVLDLGSGGGI
    DVFLSAQAVGSKGKAIGVDATPEMIWRARKAAKEMNATNVEFRLGEIECMPVESNTVDVVISNCVINLSPDKEKAFMEAF
    RVLRPGGKLAVSDMVLTEDVKADEQEMFKSWAS
    CIGGAIPLDEYVGKMKAAGFKDIEINSRHTYTSEELALMLGDTGCCG
    SGCGCGTGITTLTGSKALSKVATVKITARKE

    >gi|282163495|ref|YP_003355880.1| hypothetical protein MCP_0825 [Methanocella paludicola SANAE]
    MMQEPLRWGKDARKALDEAKRTGRLALLFFHSNQCSGCKATIAKTLPDPKVSKFIERIFSPAMFEVSEPGSQELMKKYGA
    QWTPTFVVTDADGNEIYHWVGYLPPGDFCAEMLFAEGRAAFKNKDWDRAERCFNSVAERFPDSEEAPEALYYTGVARYEK
    THDATDLADTSKKLNAKYPNSSWTKKASVWGE

    >gi|282163640|ref|YP_003356025.1| putative FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanocella paludicola SANAE]
    MLSFDVIVIGSGAGFIVVDNALAKGKRVALVEKGPLGGTCLNNGCIPSKILITPADIIRSFQDAKAIGVEGEVTKVDFPS
    ILGRFRALQEDEHKHMLEEIKASKNLSFYPVVGEFIGDYTLKVGEETIMAPKIVIASGSRPAVPPIPGLKETGYIDNITL
    LDLKKLPESLAIIGAGYIGCEYGHFFSAMGTKVTLIGRPPVVLDNEDPEVSAAITKALPRYMDLMVGHEVTRVEKSGNKK
    AVIARSMKDGKEVRIEAEEVMLAGGRRSNSDLLKPEKSGVATDKKGFIIVNEHLETNKPGIYAFGDAIGRYMFRHTANYE
    ADVVSINLLSLLKTAVDFHAVPNAVFTHPQAAHVGMKEAEAVAAGKKILVGRARYTDTAKGYALNAQDGFVKVVTEEGTG
    KILGCSVVGEFAPEIVQQVVWLMNTREQDYTPVVRGQIIHPAISEVLGRAFGNLEHPEHHHNTN

    >gi|282163646|ref|YP_003356031.1| putative glutaredoxin [Methanocella paludicola SANAE]
    MPRVSMYTLSTCPWCRKTKQFFRDRQIPFDFVDYDLADTDEQDRIVADMRKHTSDISFPYVVIGDRVIQGYDPDKYEQIL
    KEAGGK

    >gi|282163726|ref|YP_003356111.1| putative heavy metal transport/detoxification protein [Methanocella paludicola SANAE]
    MEGKEQKKVVLLLDGLSCPDCAAKIGAVLKNSKGVSGVEVLYMASKVKVDYDPAVTNVENFVSLIEKLGYGVKSTKPLN

    >gi|282163739|ref|YP_003356124.1| putative carboxymuconolactone decarboxylase [Methanocella paludicola SANAE]
    MKFENTIKSLFGKEPDEAVKELLKNIEEDYGEVPFILQSMSDKPNVLLPKIIYDDAVLRSPDHLDEKTVELITIGVATAL
    KCDH
    CLNMHLRVADRKGISDEEVFEAILIGSALSSTAVMAQAMRVYEKHKKEFKSKDDAEVECEGCIAYENHNGKHNSD

    >gi|282163795|ref|YP_003356180.1| methylated-DNA--protein-cysteine methyltransferase [Methanocella paludicola SANAE]
    MIEDICNHAIILIIIMLDYLYSDYLGLYVTVEYDKNVIKSLSMTSNKPAKKPVGSKVIRSIETYFKNGQGDFSGYKFDLE
    GMTPFQRSVLEAISRIPAGETMTYGEVAAAAGKPGAARAVGNVMAHNPIPLMLP
    CHRVVASNGLGGFTGGLEVKRKLLKL
    EGAL

    >gi|282163881|ref|YP_003356266.1| peptide methionine sulfoxide reductase MsrA [Methanocella paludicola SANAE]
    MSGPDKNLRMKGQVTIVSENLQKADFAAGCFWHVEEAFRHIPGVVSTAVGYEGGRTENPDYREVCTDRTGHAETVQVTYD
    PSKVSYDVLLDVFWSHHDPTTPNRQGPDFGTQYRSVIFYHNKEQEAAARASKEKLQKSGKFKKPIVTEIVPATKFWRAEE
    YHQQYLEKNNLKGCGI

    >gi|282163930|ref|YP_003356315.1| putative glutaredoxin [Methanocella paludicola SANAE]
    MPTLIIYTQPTCGYCQELKDYLRDNNIPFEEKDITKDRAAWDDLVNKYKARATPLVVFGEKTMLGFNPDELKKMLSAEQA
    PAR

    >gi|282163950|ref|YP_003356335.1| hypothetical protein MCP_1280 [Methanocella paludicola SANAE]
    MIMRRMKAEGLAHNTYFISSGGEAVVIDPRREAGDIENCMDLARGRCTKIKYILETHRNEDFTIGSVDLKKRTGAKIGHS
    ANTPFTYGDIALKEGDSLPFGDMMLNVLETPGHTCDSLTYVLHASDGIPLAAFTGDALFIGSTGRIDLPGKDVEEKNARA
    LYHSIHDKILPSGDHVLLYPAHGAGSVCGVGISDRDESTLGYERMTNAQLSMDEDTFVKTKLEEKFVRPTYFRKMEQYNL
    HGPPLLESRMKPEALSLAEFKGAVRDRPIVDTRTPPAFGGGHIPGSYSIWLEGMTLFPGWLLDYDRETLLLTDRDEDVKT
    ADKFLARLGYDKCCGYLCGGFDVWQNAGMPIEYTHDISVEELNGRLAAGDITLTDVREPAEWERGIVPGAAMTFVGHLPQ
    RLPDLPRNKPIATM
    CSVGHRGSIGASILERAGYTNVYNVLGGFKAWKNKGYAVTTPKVTAPKPEEAVT

    >gi|282163952|ref|YP_003356337.1| hypothetical protein MCP_1282 [Methanocella paludicola SANAE]
    MGRYLHWFIAGVAIGLLNILSYAVKKPLGVSTSFVTAGAIGVRAIDKPLVDKNPYLKEHAKVDYQFILVVAMALGGLVSS
    RLFGRSAGNPGRTRSIAGIIRQLAGGFLMLFGARIGKG
    CTSGNILSGDAQMSLGSMLFSLATFVAGALTLLVFGDRR

    >gi|282164040|ref|YP_003356425.1| cadmium-transporting ATPase [Methanocella paludicola SANAE]
    MTEHEKEKCNCGTCHEEEESHEEKGTCSCGTCHDEVECHEDHEETECQVCRIEPEGKGPLRETGFKIDNMDCADCAKKLE
    ERIAKVHGVTSVKFNFGTATLNIKHTGAASDLLDVVEQSGYHVAADTFKITQFDVQELD
    CIDCAKKFEKAIAMTPGVIRA
    SLNFAVGKLIVEHTCPVDDILAAARDIGYTIKVSGTKEKGSFFTRHRPVLITVVSGLLTVTGFTLSHLNVPPYIPILLYF
    MAIVVGGSHIAKSAIYSLKTMTADMNLLMTIAIIGAMAIGQWEEGATVVVLFALGNALQSYTLDKTRNSIKELISITPND
    AAVIRNGSEVRLNTALINVGDMIVVKPGEKIPMDGEVISGLSYVNQAPITGESMSVEKEPGSVVYAGTINENGALEIKVT
    RLAKDNTLSKIIHMVEEAQVQRAPTQVFLDKFTKYYTPAVILLAAGVAIIPTLMGQPFYTWLYRGLVLLVISCPCALVIS
    TPVSIVAAIGSASRNGVLIKGGSYLEEIGRARAIAFDKTGTLTKGKTAVSEVVNFDSLDTAQIMNIAASLESKSGHPLAA
    AIIRANHGQTPMPVENFQSVTGKGVTGTVDGVDYTLGNLKMFEAVNENVQQTVAHLQEAGMTPVILGKDHAILAVIAISD
    EVRPESRELVKDLHKSGLKEVVMLTGDNNRMAKAIASDIGLDGYFGELLPEEKANIVKGIRKAHGNVIMVGDGVNDAPAL
    AASNVGIAMGATGSDTALETADIALMANDLTKVDYTIRLGRHTLSIIKQNVIFAIAIKAVFIGLAVFGMANLWMAVFADM
    GASLIVILNGMRLIRTH

    >gi|282164153|ref|YP_003356538.1| hypothetical protein MCP_1483 [Methanocella paludicola SANAE]
    MAGNRINILGTDELKERLSDPKKVIIVDARDEEDYKKMHIPGAISIPVYDIDKMSDTLDKDKEVITYCSGGMCDASTDAA
    NILTKKGFKNVSEYKGGIQDWFAGNNPTE

    >gi|282164246|ref|YP_003356631.1| CoB--CoM heterodisulfide reductase iron-sulfur subunit A [Methanocella paludicola SANAE]
    MTEKKPNRVGVFICHCGTNIAGVIPIEELKAYAKTLPNVVHADNYTYMCSTPGQEKIRTAIKEQNLDAVVVAACSPRLHE
    PTFRKASAAGGLNMFIFEMANIREQSSWIHMKEPEKATQKAKDIIRMSVARASLLEPLDTKYIPVEKSIMVIGAGVAGIQ
    ASLEIADSGITTYLIEKEPSIGGNMSRLDKTFPTLDCSQ
    CILTPKMVDVDRHPNIKTMTYCEVEKVDGYIGNFTVTVRKK
    ARGVKEADCNGCGDCAAVCPVTKGNEFDLGLGPRKAIYVPFPQAVPLKYTVDFNSCIKCELCVKKCGDKNAIDLNMKDEL
    VEIKVGTIVVAAGFDLYEIEKKEEWGYGRFDNVITGMQFERFINASGPTGGKLIRPSDGQKPHNVAFVLCAGSRDQDANP
    YCSRVCCMYSLKHAHQIMEKMPGVVPWLFYMDIRAFGKAYEEFYYRIQDEGAKFVRGRVSYIEEDPATKNLIVHAEDTLL
    GTPVTLEADVVVLASAIVPKATTELLRNKLTISRSPDKFLLEAHPKLNPFSTSTDGIFLAGCCQGPKDIPDTVAQAAGAA
    AAAQVPINQGKVALEPIAAKVSEELCAGCGICEAQCPYKAISMVSLADGKRRANVNDAMCKGCGTCGATCPGGAIKMQHF
    TTPQIVAQIDAFLLGGGQ

    >gi|282164249|ref|YP_003356634.1| tungsten-containing formylmethanofuran dehydrogenase subunit F [Methanocella paludicola SANAE]
    MFPGYAKRLDNNRLDVEQKLLLTKSNLTVELDKCTGCGVCIDACPEEAITRGAVGASGRGKAKVAKIDVDEKKCSFCGVC
    NIMCPFDAIKLTVDGQPKLPIIEQQGFPVLEKKAKIDPEKCTH
    CVLCEEVCPRDAIKREVADVDQGHKASSTMKYSIDYK
    LDEDKCTLCGICAEACDAFKIDYKEPTPLTVKKIGKLNFDEKKCDACKVCVEICPEDALQIERKILEEPKLKGKVDIDLE
    KCTTCSWCQVICPQEAAKVEKLFEGELTINTDKCPAGCSTCVEICPCNALYLPLVEEAGQKPGKLSYNKDFCMYCGACVT
    ACPADGTITLKRSKVNVTGEKTNLFNKIEAKLLEEKTPKIQGA

    >gi|282164390|ref|YP_003356775.1| putative pyruvate dehydrogenase E3 component [Methanocella paludicola SANAE]
    MVVGDIEVGTDVLVVGAGPAGYTCAISAARQGLDVTLVNKSELGGVCLHKGCIPVKTLINVYRLAEDIKIASTMGLKAEG
    ASVDRRKAYEWKDTVVGKLEAGIRELCRGSGVQMMEGSCSFLSSSRAVVSGPSGIQHVIFKRAVIAAGGRHKPLPGIPFD
    GSLVINPDEALDMPDEGTAILGGGYAAITIAALMASQNKKFTIIHKKEHILTFLDEEMLRPVMRRFQEKGVAVHAASSWT
    VKRMGDRVRVELDIEDKKETLEAKKLVPDNGMIANTDGLGLENTAVKTRKDGFIITGENYRTDDPSIYAIGDVCGMHGNA
    STAYREGESLADILAGKTGLPDTIVTPLTMSTDPEIASAGYTETKAREAGIDVIVGRFPFTANGKAVSIGKTTGFVKVVA
    EKSSHRILGMHAVGYEAFDILQEGVLAIEMGARLEDVVLTLHPHPTLCEAVREACADALGESTNIRENK

    >gi|282164393|ref|YP_003356778.1| hypothetical protein MCP_1723 [Methanocella paludicola SANAE]
    MATEQIKFISMQHLKRVMEGSEPYRLVDVRGKEDYDKEHIKGAMSLPLDDLDRAKSLFKPDELIIVYCDSFVCSASSSAA
    KMLAGMGFHNVRDYKGGVREWKMGGLPTESS

    >gi|282164400|ref|YP_003356785.1| putative glutaredoxin [Methanocella paludicola SANAE]
    MADIRIFSQPTCPACNEVKEYLKGKGVPFTDYNILEDDKALEEMLHVHKVRVTPLIIINDKKKIIGFDVEEIEKALAENQ


    >gi|282164483|ref|YP_003356868.1| hypothetical protein MCP_1813 [Methanocella paludicola SANAE]
    MYEQKVRTISFDELLQKFKNNERFVLVDARSGEDYDKSHLPGALSIPVEEIRDYAGRLDKDEEIITYCGGFQCPASTMAA
    KEFMSLGFKDVLDYKGGIQEWSEKRYPTESS

    >gi|282164574|ref|YP_003356959.1| putative thioredoxin reductase [Methanocella paludicola SANAE]
    MAEETVYDVAIIGAGPAGLTAALYCGRANVSTVIFGDPFDSQLAKAGDVENYPGFESIHGIDLAEKFRKQLDKYKIEPVT
    NYVGRITRNGDLFVLSTDVGEFQSKSVIVSTGSKHRELNVPGEKEYLYRGVSY
    CAVCDGSFYKDKSVAMIGYGEQAASAA
    IYLAGLAKHVIVLTRKPDMESPMHAGQLKALDNVEVIGEAKILAIEGNEFAERIRFKENGGEEKSVRVDGIFIEGGVPNS
    VLANDLGLELDAKGNVAVERPDMETKVEGVFAAGDVTGGLHQISKAVGEGACAAVSAAIYIKKKFKAKK

    >gi|282164655|ref|YP_003357040.1| hypothetical protein MCP_1985 [Methanocella paludicola SANAE]
    MIFRRIKSEGLAHLSYFIGSGGEAAVIDPRRDVDAYLDMARQSCMDIKYVLETHRNEDYVIGSRELEARTNCRILHGRRL
    PFKFGEGIGDGDRIRVGDLRIRALETPGHTPESLTYVLYDTGDVPLMAFTGDALFFGTTGRTDLWGTPEEAAGLLYDSIH
    KKIVPLGDQTILCPAHGAGSVCGTGFSDRDDGTIGGERLTNPDLRLDKEKFIAKKKAEPLERPPYFKQMESFNLNGLPVT
    GGPHPCRPMNVPQFREAISNGTLIDARMPPAFSAHMPGAYSIWLDGMATWPGWVVNYQSPIYLLLENEEDAAAATRYLYR
    LGFDNVKGYLCGGFQRWLNAGQDTEFLGLLVPDALAGMLAEGKVTVLDVRSDAEWRNGRIKEATHIYVGELEKRIAEVPK
    GKPVACI
    CSTGLRASLASSILKKAGIKEVYNVLGGITAWKAKDYPLLYEKMLEK

    >gi|282164659|ref|YP_003357044.1| CoB--CoM heterodisulfide reductase iron-sulfur subunit A/F420-non-reducing hydrogenase iron-sulfur subunit D [Methanocella paludicola SANAE]
    MRPATGVFICHCGDNIAGAVDIGRLKRAARAEGAECVEDYPYLCSAEGQALIKGRIREMGLERVVIASCSPIVHERTFRD
    CVKDAGLSPYLLDIANIREQCAWVPSEDPTARAIDQVRSSIYGIREARPLDNITITSEKSVIVVGGGIAGMTSALALAKQ
    GIEVHLIEASPTIGGNMVKIGKVFSPDRLTEECAM
    CSLAPIMSEVARNKRIHIRTLSRIASIKGHAGDLTVTLASEPRHI
    DPKKCMSCGKCAQACPVTVKDEWNAMLSKRKAAYRPFPQAVPSSYTIDDKACKKCGSCVKACGAGAIDLSAEGTVETLHA
    GAVIVATGHREMDPTAKYEFGYGKYEGVYTQTELARLLAVNGPTSGRLEDPATGMAPRRIVMVQCVGSRDEKPGSIPYCS
    KICCMVALKHASYIRDHFPGTEVYICYTDIRAPGSYENYYREVQKKGVKFIRGRVAEVQREGPLVVKVEDTLGGGPMELE
    TDMVVLSCALEPSSGTMQTAKALGIGLTPELFVKEKHPKLDPSSTTSRGIFVCGTAAGAKDITDSILQARAAASKAAELV
    NAPIDIEPKYAVIDHEKCTSCGACVKLCPYGAAYTNGRITIDPLSCIGLGGCILRCPEHAISLPSCSDEALYARIDGMLA
    SGPRMIAFLDENIAYVAADNAGVNRVACPSSVRIIRLPSIMRLEPKHLIYALNNGASGVFLADGTTNSPEGAVKANVAKR
    VEELKKALAEGGIDPGRVFYYEAYLPHYRGLAARMERFEAALNNKDIIMPGQAEGCLDEMHEAQSL

    >gi|282164721|ref|YP_003357106.1| peroxiredoxin [Methanocella paludicola SANAE]
    MEQAASYRPPGPVSLGMLAPDFEAKTTHGKVKLSDYKGKWVILFSHPGDFTPVCTTEFIAFARKHGEFVKRNVQLLGLTV
    DSLPSHIAWVRSIEEQMGVHIPFPTIADLDTRISRMYGMIHPDMSDEAPIRSLFIIDPNRIVRMIFFYPAGVGRSTDEIL
    RIMDALQLTTREKVATPADWKPGDPVLVSSPHTQQGAEARDRSHDGLECKAWYLCTKKL

    >gi|282164847|ref|YP_003357232.1| hypothetical protein MCP_2177 [Methanocella paludicola SANAE]
    MRYRLAVILIAAALLVSGCICCGGQEADHSAAMAPIDSALVNGPVFVEFGAEWCSWCTVEAPIIEELKAEYSNVTFMEVD
    IDENGTLADAFYVSSVPQMNVIVNKTQNGSYLYADVSGRITESRRSSAIIGYHERPNLKKALDAAVAKRAVM

    >gi|282164932|ref|YP_003357317.1| putative carboxymuconolactone decarboxylase [Methanocella paludicola SANAE]
    MPYKEFEVFTKKMGYVPQLLELIKDTDPEMFETISRLDEVILKDGAMSEKNKRLIAMCMAAQAQCEKCVDVHAKAAMYHG
    ATKYEVMEALFVAMLVGGAPCLSAARRTIGFLKGEMDPMEFAGE

    >gi|282164946|ref|YP_003357331.1| hypothetical protein MCP_2276 [Methanocella paludicola SANAE]
    MRVMTANRIYITAIAALIACAAVLGGTHCFAQQMQQPVTQAKVSMSDIDAALAKGPVFVEFETEACHYCKEQRPISQALA
    SDYSGKITFFFVDAMENRDLAKSFQVTGVPQMSVIASKSDGKYTYIGRNGAASDSVSASRFVGLTQKEDLKPALDAALQK
    RT

    >gi|282165068|ref|YP_003357453.1| putative glutaredoxin [Methanocella paludicola SANAE]
    MHVEHVDGKNNGTVMLYALSTCVWCKMTKKLITGLGVAFDYMFVDLLQGAEQEEAIAEIKKVNPSCSFPTLVVNGQCIVG
    YQEAKIREALK

    >gi|282165268|ref|YP_003357653.1| NADH oxidase [Methanocella paludicola SANAE]
    MSSDRIVFIGAGGAGITTAFTLARKRPDMKITLFSKDPIVAYSQCGMPFVLDRKIESFDKLVLYTPEVFKDLGLDVRTGT
    AVTGIDLEAKTVTIEGGEALEYGKLVISTGSVPFVPPVPGVGLMGVYRLLTLEDGKRLAEAMDNVESVAIIGGGPIGLET
    APAFLDRFIDVTIIERMPQLMPGALDPDMTKMLEDHLKDKGAVVITGKGVDSINGKDRVESVSVGGETIKADMVLLAAGV
    KPNVELAKKAGIDIGPAGGIDVDEHFRVKKNGKVLDDVYAAGDCVEEVNAITGRKVVCAIGTVANRQSGYLANELMGMGV
    PYGPVLCPAITVVGDLQIGSVGLTTRACEAAGIKPISFKAKSNTRARYYPEGGQLDIKLIADGRRVIGAQIIGKEGVHGR
    INVLTLAIHKKMTPAELADVETCYAPPVSPMIDPITYTAEMLALRCKKYKK

    >gi|282165409|ref|YP_003357794.1| hypothetical protein MCP_2739 [Methanocella paludicola SANAE]
    MALKEDICSAMENYMMTSPPDWNVVRVGELKKALDAGQKIFLLDVREPAEYQAGHIEGAVNVSVKELPKRVAELPQDRDV
    KMVAY
    CASGIRSAYATMFLRVYGYRDVRTMEHGIREWVSAGYPVV

    >gi|282165438|ref|YP_003357823.1| CoB--CoM heterodisulfide reductase iron-sulfur subunit A [Methanocella paludicola SANAE]
    MTEKKPNRVGVFICHCGTNIAGVIPIDQVREYAKTLPNVVHADNYTYMCSTPGQEKIKAAIKEQNLDAVVVAACSPRLHE
    PTFRKASAAGGLNPFIFEMANIREQSSWIHMKEPEKATEKAKDIIRMSVARATLLEPLDTKYIPVEKSIMVIGAGVAGIQ
    ASLEIADSGITTYLVEKEPSIGGNMSRLDKTFPTLDCSQ
    CILTPKMVDVDRHPNIKTMTYCEVEKVDGYIGNFTVTVRKK
    ARGVKEADCNGCGDCAAVCPVTKGNEFDLGLGPRKAIYVPFPQAVPLKYTVDFNSCIKCELCVKKCGDKNAIDLNMKDEL
    VEIKVGTIIVATGFDLYEIQKKEEWGYGRFDNVITGMQFERFINASGPTGGKLIRPSDGQKPHNVAFVLCAGSRDQDANP
    YCSRVCCMYSLKHAHQIMEKMPGVVPWLFYMDIRAFGKAYEEFYYRIQDEGAKFVRGRVSYIEEDPATKNLIVHAEDTLL
    GTPVALEADVVVLASAIVPKETTELLRNKLTISRSPDKFLLEAHPKLNPFSTSTDGIFLAGCCQGPKDIPDTVAQAAGAA
    AAAQVPINQGKVALEPIAAKVDDDLCSGCGVCGSLCPYKAITLNEIEDGKRRASVNDAMCKGCGTCGAACPAKAITMQHF
    KSEQIRAQIAALFTPAGGA

    >gi|282165482|ref|YP_003357867.1| hypothetical protein MCP_2812 [Methanocella paludicola SANAE]
    MSHFNLMPAKYGHAFSRRRYYRKFLLAAALMALLLLVPAMGLCASCETVRVTYVYSPLCTICEHSGPSIRAAVNDSMSAG
    IDVRYEEHMFSSREGRADMERYGLSSVPAVIVNGRAIRPGDFDGDTKKLESLLRRAISDACHYKTPVTLERKIVKVAEKD
    TVSVVTIIANSGTEPVYATIRGGTCEGVSVVEGETSWEGTVMPGERQYLAYEADISRNVRSLPPQALTYSDSLGEHSVSC
    PETPVFILKKLSVAAVFIAGLVAGFNPCLLAVMAFVSAMALSMKGRRLDIIFNLLAFSAGLLCIYLLMGIGFLRLIESVP
    SLTSALKTAIIVLLAGLAGFAFYEAWQVKKDPDRASLFKSFVDRYKPLYKKYCLPASFGLGGAFGLIKMPCVGGIYVGIL
    GAIAGSGEAGRGLLLLVAYNFGVVLPVLALGALLVLGMSPEKVDRLRKKHRYALKLATGLILATMAAGFMLNVI

    >gi|282165514|ref|YP_003357899.1| putative peroxiredoxin [Methanocella paludicola SANAE]
    MEYRIEVGEMAPDFRLKSAAGRDVRLYDCKNKKTVLLFFFNHDKPGCLERLKTLAEDYGKFKDAGVAVFPVSILKVDEGK
    TLVQKLGLPFGILCDDDHSVVRDYKMGQCSDTPGHVCFEVIHDVEFPAMLVIDTSGIIRYKQAVGASGGPDNLTLLEECR
    KALK

    >gi|282165587|ref|YP_003357972.1| putative iron compound ABC transporter iron compound binding protein [Methanocella paludicola SANAE]
    MVSNKNLTIIVSIALIVAALALGGCTSPSAQPTATPAASANYPMNVTDDKDRTVVIQEMPERIVSLSPKNTEMLYALGLG
    DKVVGVTDYCNYPAEAANKTKVGGITNVNVEQVGALNPDVVFADSLTKKEAAEKIESMGYPVIVNDPRNVSDIERSILRM
    GKV
    CGAGDNATRLAADINASIKAITDKTATLNESQRPKVLMLLDTYDFYVAGSDCYGNDLIILAGGQNVAYELTDYKAMS
    KEAVIEADPDIIIMPVDVYSQPDFEKLRNGTEDWMQQLSAVRNGKVYAVASDPIFRPGPRVVDAAQAMAKIIHPELFS