Methanocaldococcus vulcanius M7

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|261402176|ref|YP_003246400.1| DsrE family protein [Methanocaldococcus vulcanius M7]
    MVRKFSVKGLRSPSLLIDMILSDAKDDILIVETDGEEQIKDIENLLKKYNLKYEVEGNVVKIHVGEIKADKSINVVGATC
    PGPIMMVSDMLSKMKNGEILEIICGKNALTDLTEGLKGMGNEIISVEEKEDGTYRILVKKGEKKEEEKATVKIDELFIIN
    TTGTGNAEKAYSTFMMADVALKMNLKPTIFLMMDGASLALKGECDKVKHPAFPKLGDLVRDILKKGVKVYV
    CELSAEFRG
    INEKNLEEGFEIAGAPTFLNYLSKPNVRPVWL

    >gi|261402378|ref|YP_003246602.1| selenide, water dikinase [Methanocaldococcus vulcanius M7]
    MVEKEKDIKLTSLVKLHGCACKLPSTELEYLVKGIILDEDLAEKNIIVGLGDDASVIKRNGLVIAKTVDVFTPIVDDPYI
    QGKIAACNSTSDIYAMGLLDIIGVLVILGIPEKLPIDIVKKMLNGFQDFCRENNTTIVGGHTIMNPWPLIGGAVTGVGKE
    EEVLTKAGAEEGDVLILTKPLGTQTAMALSRIPDDYKELIGIDEEEMNYIINKAIELMTTSNRYALKSLRNAEKKVGDKV
    ANALTDITGFGLLGHSNEMAKNSNVLIEINLLPCIKRTPELSKMFGHALLDGYGAETAGGLLISTKNDYKDDLIEELRKN
    KVYAFEVGKVVKKGEGRAILSKDVKIVEV

    >gi|261402553|ref|YP_003246777.1| Peroxiredoxin [Methanocaldococcus vulcanius M7]
    MCEGKMPVIGEKFPEVEVKTTHGVIKLPDYYVEKGKWFVLFSHPADFTPVCTTEFVGFQKRYDEFRKLNTELIGLSIDQV
    FSHLKWTEWIKEKLGVEIEFPIIADDRGELAEKLGMISPYKGDNTVRAVFVVDNKGIIRAIIYYPQEVGRNLDEIVRLVK
    ALQVSDEKGVAMPANWPENDLIGDKVIIPPASSVEEIKQRKEACEKGEIECLDWWFCYKKLE

    >gi|261402606|ref|YP_003246830.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus vulcanius M7]
    MASSLWYLYEFARRKWIKRFINAKSDKSSYIPPERYRKVPPIVKYPERCISCEGCKESCPAFAVEMIYSEEFQKNIPLID
    EGS
    CIACANCVEMCPTGVLEIDKHRIETEGLFFDKPKYNNLLIDDEVCVHCGNCERACPINVIERKEGRYVINMSQCISC
    KECINACPIEDAIIVVDEKTLKEKIEKAFEIKTKKIMGKLEVKESIDEVPHIVDSICLTCGLCKDVCVGEIDLNKKVIVN
    CVKCGFCIDVCPTTAIRTHKEIVPKRKDICYMVDEDMCIGCRICQKVCGSGAIKISKETKLPYIIPDLCVRGGACARECP
    VGAIKIVKPEEAEKAVKVRIIEDKIIETIEKDLISFTKKYGKVKEEIEKLSIKKLKEELRKKVYEENKRIMKKKRELQ

    >gi|261402608|ref|YP_003246832.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus vulcanius M7]
    MIEIKKPLKEIIKNIDGEEYYINEIAKKITPISYKLIYIDETKCVRCNLCYKECPVNAIEKAKVKNPAKIIEDKCVKCEI
    CAQTCPVGAIYVIEGEAEVKDEEVHYLIKEKPVPHRKIRLKSYQLDEEKCIKCGI
    CARFCPTNAIKVVRRKSIEVNLDLC
    MGCGACESVCPKKCIKVENEIGDVIRTRDIDVNKNLCVGCFVCIEECPVNAIDQDGDKVKINKEKCILCGRCVDVCPTNA
    IKMWDIH

    >gi|261402739|ref|YP_003246963.1| DsrE family protein [Methanocaldococcus vulcanius M7]
    MKFTVIITEAPYGKERAYSALRFALTALLEGVDVNIFLLENGVYVAKTEQNPSDVPNYLELLKNAIDLGAVVKVCGPCCK
    ARGLKEEDLIEGAKLATMHDLIAFVKESDNVITF

    >gi|261402801|ref|YP_003247025.1| phosphoribosylformylglycinamidine synthase II [Methanocaldococcus vulcanius M7]
    MDENDIKYIENTLGRKLNDIELAMFENLWSEHCAYRTSKKLLRMFAKTVNEKTSKNIVVGIGDDAAIIRLKDDICLAIAM
    ESHNHPSYIDPYNGAATGVGGIVRDVLSMGAKPIALLDPLRFGDIFGKEGDKVRWLIDGVVRGIGDYGNRIGVPTVGGEC
    EFDSSFDYNNLVNVVCVGLVKENEIITGKAKEPGLSLILVGSTGRDGIGGASFASKDLTEESEEDRPSVQVGDAFSEKCL
    IDAVLEAVKTGKVKAMKDLGAAGLSGASSEMCYGGGVGCELYLENVILREPLTPYEIMISESQERMLLAVEPGSEEEIIE
    IFKKYELPASVIGKTIKEKKIIAKYNEEEVVNLPLDLLCEAPLYDREAKEDLKEKEDDKEKIKMPEDLNAVLLKLLESPN
    ICSKEWIYQQYDHEVQIRTIIKPGKDAAVLRILETYPTGIALTTDCNSRYCKLNPYVGALNAVAEAVRNLATVGAEPMAM
    LDNLNFGNPERAERFWQLAECIKGLADAAEFFEIPVVGGNVSLYNETVIEGKEFPINPTPAIFVLGKVEDVEKVPGVLGN
    KIKDGDVLIITNETRDEMGGSEYYKVIHNTEEGIVPRVDLEKEKKIYKEIREIIKEGLVSEAVDCSRGGLAIALAKMAVL
    NNIGLDVDLTSYNKNNLRDDVLLFSETSGRIILAVREENKDKVLNKLSSAHVIGKVGGNRLKIKVNGRGIIDLDVNTMKK
    RYYEAFPKMMGEL

    >gi|261402830|ref|YP_003247054.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus vulcanius M7]
    MEEPRIGVYVCHCGVNIGGVVDCKAVAEFAKTLKNVVVARDYKYMCADPGQEMIKRDIKEYNLNRVVVAACSPRLHEPTF
    RRCVAEAGLNPFLFEFANIREHCSWVHMHEPEKATEKAKDLVRMAVAKARLLEPLEFIKVGVTKRALVIGGGVAGIQAAL
    DLGDMGFETILVEKSPSVGGRMAQLDKTFPTNDCSI
    CILAPKMVDVAKHPNVKLYAYSEVVDVQGYIGNFKVKIMKKPRY
    IDETKCTGCGQCAEVCPIEVPNEFDMGLGMRKAIYKPFPQAVPSKYTIDKEHCIDCGLCAKVCGPNAIDYDQKPEFIDVE
    VGTIICAIGYDPFDPTVREEYGYGVYDNVITALELERMINASGPTGGKVIRLSDGKKPKRIAFIQCVGSRDAKVGNRYCS
    NVCCMYAMKNSQLIKEKAPETDIDIYYMDIRAFSKGYEEFYERSSKQYGITFIRGRPAEILEDPKTKNLIIRAEDTLLGE
    IIEKEYDLVVLSVGMIPTKSADQIQRILGISRTPDQFFMEAHPKLRPVDTATDGVYLAGACQGPKDIPASVAQGSAAASR
    AAIPLSKGEVEVEPIVATVNKEICGGCGVCVKQCPYGAPRLIEEDGKLVCDVIAALCKGCGTCVAGCPSGALEQNHFKTI
    QLYKQIEGAFKDPA

    >gi|261403179|ref|YP_003247403.1| redox-active disulfide protein 2 [Methanocaldococcus vulcanius M7]
    MLVIRVFGTGCPKCDQAYENVKKAVEELNIEAEIIKVSDINEIAEWVFFTPGIAFDDLLVFEGETPSVEEIKEELLEYLK
    EKEG

    >gi|261403332|ref|YP_003247556.1| redox-active disulfide protein 1 [Methanocaldococcus vulcanius M7]
    MSKVKIELFTSPMCPHCPAAKRVVEEVVSEMPNDVDVEYINVMENPQKAVEYGIMAVPTIVINGDVEFIGAPTKEALIEA
    IKRRL

    >gi|261403423|ref|YP_003247647.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanocaldococcus vulcanius M7]
    MDVKVAVVGGGPAGRTTAIALSKKGIDVDLYEKDKIGGTCLNYGCTYITGLREMADVLNILSSIKGEKIKLDELVQFNEL
    QEKINKIQKRIRKKLEKETINAGVNIKYKEFKDKEDDYDYTVYATGKIYTNTFREYEDVLTHKDIPQLKDLPENILVIGG
    GTVGVEYASLFADFGSEVVLYARSRILKDITDEDIRNYIMEKLINFKIIHKEEELKKFLNNEDYVKILAIGGKGRFKTDK
    YLRVLNEKNTYACGDCLINGGGNTPVSRMEGRTVAENIYNEINGLKLKEVKYNLIPKTVRLSLTLSYVGKQTKEHKTIRS
    SVGKGNFFKVLSDVGINRIYYENGKVVGAISTIPASEVLPYFAQFIKGLDVYNDFIEIHPSTDIFYKEFRRI

    >gi|261403431|ref|YP_003247655.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Methanocaldococcus vulcanius M7]
    MRVVIIGSGAAGLTTASTIRKYNKDIEIVVITKEREIAYSPCAIPYVIEGTIKSFDDIVMHTPADYKKERNIDIITETAV
    VDVDSKNNKIKCIDKNGNEFGMDYDYLVLATGAEPFIPPIEGKDLKGVFKVRSIEDGRNILKYIEEEKCNKAVVVGAGAI
    GLEMAYGLKCRGLDVLVVEMAPQVLPRFLDPDMAERVQKYLEKEGIKIILSKPLEKIIGEEKVEAVCVGDQVYEADMVIM
    ATGVRPNIELAKKAGCKIGKFAIEVNEKMQTSIPNIYAVGDCVEVVDFITGEKTLSPFGTTAVRQGKVAGKNIAGIDAKF
    YPVLNSAVSKIGELEIGGTGLTAFSANLKRIPIVIGRAKGLTRARYYPGGKEIEIKMIFSENGTVFGCQIVGGERVAERI
    DAMSIAIFKKVNAEEIANMEFCYAPPVSMVNEPLSLAAEDALKKLH

    >gi|261403507|ref|YP_003247731.1| thioredoxin reductase [Methanocaldococcus vulcanius M7]
    MIYDTIIIGAGPGGLTAGIYAMRGKINALCIEKENAGGRIAEAGIVENYPGFEEIRGYELAEKFKNHAEKFKLPIVYDEV
    VKVETDKKPFKIITKNSTYLTKTIVIATGTKPKKLNLNEDEFAGRGVSY
    CTMCDAFFYLNKDVIVIGRDTPAVMSAINLK
    DIAKKIILITDKQELKVAEPIMLDKLKEADNIEIIYNAKPLEIVGKDRAEGIKIAINGEEKVIKADGIFISLGHVPNTEF
    LENSGIELDKRGFIKTDKNCKTNIDGIYAVGDVRGGVMQVAKAVGDGCVAMANIIKEIQKGI

    >gi|261403541|ref|YP_003247765.1| methyl-accepting chemotaxis sensory transducer [Methanocaldococcus vulcanius M7]
    MKLEYKVFLISLIMYVIIAVVANFFNNFIILIILGGIFSVIITFLVKNTTSAPIKEIINIIEKEDIVDVDTINLPSDDFK
    VLYEKICTLVKKLKEKEKELEIMEKEIAQTFKEALNALEHLANGDFSVRLNENRERNKFQKMFNKAINNVSTIIENIRKE
    VLDLNLQIEVLKKETKKAREAIEQMSDAAQQVATAASDQSAKLQDITQEVEKTDELAKRTENLSEEGEKVSIEASEKADE
    GIKKIENAVEAMQKISNVIDELSKAIQELGTKSKKINEITALIKDIAEQTGLLALNASIEAARAGEAGRGFAVVASEIKN
    LAEEIGKSVDDINRTIDEINSQIEKTVNLGIVGKNEVDKGVIAVDEVNAVFLKIKESVDNTTQKIKEIKRSAKVTIDNME
    KALKDIQDLASISEEFTATAEELSANAEEERKAIEEIEEVIINLEKVSKSVKENIMRIKTSKNITVDEAFKLLNNEEYVF
    INVVPEDKYDGKIPNSIHIPINELENRLDEIPKDKKVVVY
    CKLGFTSPRGYMILKEKGYDVYNMEGGLKAWREKGYPVEK


    >gi|261403596|ref|YP_003247820.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus vulcanius M7]
    MSPRVGVFVCYCGANINGVVDCEAVRDFAEKLDGVVVAKTYPFMCADPGQNLIKEAIKEYNLDRVVVAACTPKIHEPTFR
    NCIKDAGLSPYYLEFVNIREHCSFVHMNDREKATKKAMELVAGAVERAKRLEDVPQKIVEVDKSCLIIGGGIAGIQAALD
    LGDQGYKVYLVDKEPSIGGRMAQLAKTFPTDDCAL
    CILAPKMVSVANHPNVELITYAEVKNVEGFIGNFEVTIEKKPRYV
    DEDICTGCGACAAVCPIEVPNEFDLGLGTRKAIYVPFAQAIPLVYTIDMEHCIRCGLCEKACGPGAIRYDQKPEEIKLKV
    GTIICAVGYDEFDCTLKEEYGYGIYDNVITTLELERMINPAGPTGGHEIRPSDGKHPHRVVFIQCVGSRDAKVGKHYCSR
    ICCMFALKNAQLMKQHDPNTEVYICYMDIRSFGKGYEEYYRRAQEQFGVKFIRGRPACIMEDPETKNLLVRVEDTLLGEI
    VEIEADLVVLSAGLSPRPDNPKLAKMLGLELSPDGFFKELHPKLAPVNTKVDGVAIAGVAQGPKDIPDTVAQAKGAASAV
    SIPMAQGQFKIEMIRAIVDEDVCGGCQVCAKMCPYNAITYVEKDGHLIAQVNDVACKGCGACAGACPSGAMQLRYYRDEQ
    VIAFVDGILEAHQKLEAK

    >gi|261403707|ref|YP_003247931.1| HesB-related (seleno)protein [Methanocaldococcus vulcanius M7]
    MKKVNISEEAKKFILEKLKKAGRDEVVIYFEGFACGGPKFGIAIAHPSEKDKLIYDGEFKLYIDPIADQWLDEVDISLKR
    SIFGKYVKIRGSSSC

    >gi|261403824|ref|YP_003248048.1| methylated-DNA/protein-cysteine methyltransferase [Methanocaldococcus vulcanius M7]
    MIVQINDYFIGMIFKGNRLVRNTIPLREEEIFRFYNGKILDEPNKMCMKVGKIILKLYFADLDDKIARDLIDYELNVSSF
    TKKVLDEVKKIKFGETVSYGDIAKKLNTSPRAVGVALSKNPLPLIIP
    CHRVVAKNSLGGYSYGIEKKKFILEMEQIKKRL
    K