Methanocaldococcus infernus ME uid48803

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296109044|ref|YP_003615993.1| DsrE family protein [Methanocaldococcus infernus ME]
    MIEFSVKGLRNPEILVQQVMLMSGEDLIVVETDGEEQIKKIEELLKKNNVKYEVEGNKVKIFAKEIKADKTINVVGATCP
    GPIMMVSDILEKMNVGEILEIICGKNALTDLTEGLKGMGHEIISVEERNDGTYRILLKKGEKKKEEVKSVEINELFIINT
    TGTGNAERAYSTFMMADIALKMGLKPTIFLMLDGASLALKGECDKVKHPDFPKLGDLVRDVIKKGVKVYV
    CELSAKFRGI
    DEKNLEDGFEIAGAPTFLNYLSKPNVRPVWL

    >gi|296109066|ref|YP_003616015.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus infernus ME]
    MTTPRIGVYVCYCGTNIKAVVDCEAVKEFAEKLDGVVVARTYPFMCADPGQKLIQEDIKKYNLNRIVVAACTPKIHEPTF
    RACIKDAGLSPYYLEFVNIREHDSFVHMEDKEAATKKAMELVAAAVERAKRLEDIPQKVVEVEKSCLIIGGGIAGIQAAL
    DLADQGYKVYLLEKEPSIGGRMAQLAKTFPTDDCAL
    CILAPKMVSVANHPNIEIITYAELKEVSGYIGNFEVTIEKKPRY
    VDESKCTGCGACASVCPIEVPNEFDLGLGVRKAIYVPFPQAVPLVYTIDMDYCIKCELCSKVCGPGAIDYNQKPEEIKLK
    VGTIICAVGFDEFDCTLKEEYGYGVYDNVITTLQLERMINPAGPTGGHEIRPSDGKHPKRILFIQCVGSRDLKVGKPYCS
    RICCMFALKNAQLIKMHDPSAEVYICYMDIRSFGKGYEEYYQRAQEQFGVRFIRGRPACIIEDPETKNLIVRVEDTLIGE
    ILELEVDLVVLSAGLSPRPDNKKLAKMLGLELSPDGFFKELHPKLAPVNTKVDGIAIAGVAQGPKDIPDTVAQAKGAASA
    VAIPMAKGKFEIEMIRAIVDEEICGGCEICAQVCPYNAISYVEKDGHLVASVNDIACKGCGSCVAACPSGAMQLRYYRDE
    QIIPAIDAMLKVHNELSK

    >gi|296109102|ref|YP_003616051.1| thioredoxin reductase [Methanocaldococcus infernus ME]
    MYDTIIIGAGPSGLTAGIYAMRGKLKALCIEKENAGGRIAEAGIVENYPGFEEIRGFELAERFRKHAEKFKLPIVYEEVV
    DIEIGEGKHKVITNKNEYETKTILIATGTKPKRLGIEEKFIGKGVSY
    CTMCDAFFYLNKDVIVFGRDTPAVMSAINLKDI
    AKKIILITDKSDLKVAEPIMLDRLKEIKNLEIIYNAKPLKILGEEKAEGIKIEVDGKEMDIKADGIFISLGHEPNTEFLK
    GKVKLDKRGFIITDENCRTNIKGIYAAGDVRGGVMQVAKAVGDGCIAMANIIKEVKG

    >gi|296109179|ref|YP_003616128.1| phosphoribosylformylglycinamidine synthase II [Methanocaldococcus infernus ME]
    MDENDLKYIQKTLGREINEIEKAMFENLWSEHCSYRTSKKLLRMFSKTINERTSKDIVVGIGDDAAVIRLKDNICLALAM
    ESHNHPSYIDPYNGAATGVGGIVRDVLSMGAKPIALLDPLRFGDPRVEKVRWLIDGVVRGIGDYGNRIGVPTVGGECEFD
    ESFNYNNLVNVVCVGLVKEEDIVRGKTKEKELSLILVGSTGRDGIGGASFASKDLTEESEEERPSVQVGDAFSEKCLIDA
    ILEAVKTKKVKAMKDLGAAGLSGAATEMCLSGCELYLENVPLREPLTPYEIMVSESQERMLLAVEKGSEEEIIKIFEKYD
    LPAAVIGRTTDTGRIIAKYKGEVVVDLPISLLCNAPLYDREEEERILEKEGRIEERVDLEEAILKLLESPNICSKEWIYS
    QYDYDVQLRTVIKPGRDAAVLRILETYPVGIALTVDCNSRFCKLNPYVGSLYTVAEAVRNLACVGAKPLAMLDNLNFANP
    EKPDRFWQLKECIRGLADAAFSFDIPVVGGNVSLYNETVIEGKEYPINPTPAIALIGKIDNIEKVPGVLDNKVEEGDILI
    ITNETKEEMGGSEYYKVLFNSEIGRVPRVNLEKEKEIYKKVVSLINRGLISGTKDCSRGGLGIALAKFCINNNIGVEVEL
    DNYNINKLREDLLLFSETSGRIILAVKEENLNEVLKEIDGYVIGRVGGKELSIKINNNKISISLGEMKKVYKEAFPKMMG
    EL

    >gi|296109195|ref|YP_003616144.1| Thioredoxin domain protein [Methanocaldococcus infernus ME]
    MKKFLILFTILLLSGCLNNNSNSHSYEAPIKDGILVFTTEYCHYCKMLKPYLEKLKEEGYNVVIIDANENRELAEKFNVF
    AVPAVFYIKDGKVVDKTIGYNPEELFNKAKKYFK

    >gi|296109284|ref|YP_003616233.1| selenide, water dikinase [Methanocaldococcus infernus ME]
    MVIRMKLTEMVKLHGCACKLPSAELEVLVKDIVKDEDLKHCLVGLGDDAAVIKKENLVIAKTVDVFTPIVDDPYIQGKIA
    ACNSTNDIYAMGLREIIGVLAIVGIPEKLSLSVAKEMLRGFQDFCREIGTSIVGGHTILNPWPLIGGSVTGVGKEEEVLT
    KAGAKVGDVLILTKPLGTQSAMALSRVPKEFLELINISEEEKEEIINKAIKLMTTSNKYSLEALRRAEEKVGDKIANALT
    DVTGFGLLGHSNEIAKQSKVNIKIDTLPCIKKTPELSKMFGHALLEGYGAETAGGLLIVAKREYKDELIDELKKVGYAFE
    VGEVVGRGDKATLSKDLKIIEV

    >gi|296109392|ref|YP_003616341.1| redox-active disulfide protein 2 [Methanocaldococcus infernus ME]
    MFGDNLVVIRVFGTGCQKCQEVYENVKKAVEELGIDAEIIKVTDVDEIANWIYVTPGVAFDDYIIFEGKVPTVEEIKEEL
    KSYLEEKE

    >gi|296109478|ref|YP_003616427.1| HesB-related (seleno)protein [Methanocaldococcus infernus ME]
    MKVEISNDAKNFILEKLKKKGSDSVIIYFDGFGCCGPRFGVAIAEPKEDDKLIYDNEFKIFLDKVAQQWLSSVKIELKRS
    LFGKYLKVGNSRDC

    >gi|296109567|ref|YP_003616516.1| Peroxiredoxin [Methanocaldococcus infernus ME]
    MCGEENYCGLPVIGDKFPEVEVKTTHGVIKLPDHYKGKWFVLFSHPADFTPVCTTEFIGFQKRYDQFREMNCELIGLSID
    QVFSHLKWIEWIEEKLGVKIEFPVIADDRGELAEMLGMISPFKGSNTVRAVFVVDDKGIIRAIIYYPQEVGRNLDEIVRL
    VKALQTSDKYGVATPANWPENDFPEEGAVIIPPASSIKEIEERKKACEKGEIKCLDWWLCYKKLE

    >gi|296109706|ref|YP_003616655.1| Rhodanese domain protein [Methanocaldococcus infernus ME]
    MDEEILARLLTFNKDVYLCIFLKDGRKMIANSEKILAGKVGGEIVRKVIDTIKKMEEEGKEIFLLEDEKIYIEKINIKKF
    LSSITIPDDTITIDEALKKKDAIFIDVRSPREFKEKTIPGAINIPLFLDEEHALIGKVYKNEGKEKAMELAIDIVSKSLV
    RILNEVKKLDRNKEIIVF
    CARGGMRSRTVALILSLLGFKKVKRLIGGFKSYRHVEK

    >gi|296109837|ref|YP_003616786.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanocaldococcus infernus ME]
    MRTIIIGSGAAGLTAASTLRGYNEEMEIIVVTKDKYIAYSPCAIPYVIEGTIKSFEDIIMRTPEDYKKRGIDVLTETEAK
    DVRDNKVELSSGEKIEFDYLVLATGSSPFIPPIEGRELEGVFKVKSLEDGKKILEYMKNCEKVAVIGAGAIGLEMAYAFK
    KRGLDVLVVEMAPQVLPRFLDPDMAEVVKNYLESLGIKFILSKPLEKILGKDKVEGILVDGQTYDVDMVILATGVRPNIE
    LAKKAGCKIGKYGIEVDEYLRTSVKNIYAAGDCVEVIDMITGEKTLSPFGSTAVRQGRVVGKNIAGLKETFPPVLNAAIS
    KIGELEVGGVGLTAVAANLKRIPINIGKVKALSRARYYPGGRELIIKLVAKDNLVVGGQIIGYERVAERIDLLSVAITKK
    VSIKELSTMEFCYAPPVKMVKEPISLAAEKILKQE

    >gi|296109881|ref|YP_003616830.1| DsrE family protein [Methanocaldococcus infernus ME]
    MKVTVVITSAPYGRERAYSALRFALTSLLEGLEVNIFLIEDGVYVAKKGQDPSEVPNYLDLLKNAIELGAKVKACGPCCK
    ARGLKEEDLIEGVELATMHDLVSFVKESDKVISF

    >gi|296109886|ref|YP_003616835.1| redox-active disulfide protein 1 [Methanocaldococcus infernus ME]
    MVKVEVFTSPMCPHCPAAKRVVEEVAKEMPIEVEYIDVTQNPQKAMEYGIMAVPTIVIDGEIEFIGAPTKEALIEAIKKR
    L

    >gi|296109934|ref|YP_003616883.1| methylated-DNA/protein-cysteine methyltransferase [Methanocaldococcus infernus ME]
    MIKINNYYIGLIFKDGYLVENTIPLKCKLEGYSEDGEEIAKIILKLYLAELSDKEARKRIRFKLLTSDFTKRVLKEVCKI
    PFGETITYGELAEKLKSSPRAVGRALNKNPLPLIIP
    CHRVIAKDGVGGYKYGVEEKIKILERERNALLRANKI

    >gi|296109957|ref|YP_003616906.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus infernus ME]
    MEIVKDLKEIFEDMDEDEELLKHIANHLSEIRGKLIYVNESICCKCNLCYKECPVDAIERAKVKRAVKIKDNCIKCEICA
    KTCPVDAIFVIEGDVNIKDSKIVLSINKKEVMKRKIRLKNYIFNDEKCGK
    CGICAMVCPTKAIKVVRKKSFSVNLDLCIG
    CGACEEQCPKKAVKVERELGNIYKEGHMEVDKELCVGCMVCVEECPIDCIYDIGGVVEIDNDKCVLCRICEEVCPTKAIK
    MISYDQEGEGKD

    >gi|296109959|ref|YP_003616908.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus infernus ME]
    MASSIFYIYEIVKRIKRVLDAKTKKEDYEDKPRFRKVPPIVKYPEKCISCEACKESCPAKAIEMVEREKKIPNIEVDSCI
    ACLNCVEVCPTGVLELDKHRVSVEGQPFSVPKFHYLQIDEEVCANCGKCERACPIGVIHKTEKAYKIDVERCITCKRCLE
    VCPLKNAIVVFTEEEMNEKFDRAFRLKILKEFNKLTYEEKVEKPHIVKSLCIACLNCVEVCPGEIDIEKGEIISCLNCFY
    CLEVCPTTAIRVRKEPIAKEKVKCYVVLEEDCIGCRACYKVCKFGAITISKKTKLPYILPDKCIVCGLCERECPVDTIKL
    VNIDEAKKMAKIRTIEDDLIERLENLLQGEMSEFAKKLCNLRGKC

    >gi|296110026|ref|YP_003616975.1| methyl-accepting chemotaxis sensory transducer [Methanocaldococcus infernus ME]
    MKKILLIFLVSYFIILINLIIFKGNLAIALVSSLLSSIFITLLAIKVLTDELDKLLLEVIKKLEKGESYNLKYFKLKVIE
    KIKEILENLKKCKKKIKEMNAELKKTFDELLEAFKEFEKGNLSVRLNENRKRNKLQKIFNRALDKLTNIIENIRKEVLEL
    NTQIEILKEQAKRSKELAEQLSDAAQQVATAASDQTEKIHDIKDEIEKTHELAKKTELLSKEGEEMSLNVMQKIDNGLNK
    VENAVNTMEKINEVIERLSKAIEELGNKSKKINEISVLIKDIAKQTSLLALNASIEAARAGDAGRGFAVVASEIKKLAEE
    IGRSIEDINKTVEEIQNQIDRTVELGNLGKKEVENGVLAIDEVNKVFLEIKDSIHSTAEKIKSIRESADITIENMGQALR
    DIQDLASISEQFTATAEELTSTVEEEKKIVEELEKVIDNLNKVSKSVRDSIMKIKTTRDISVDEAHRLLGDPDWIFVNVV
    PRAKYDGKIPGSLYIPIEELEDRLNEIPKDKKVIVY
    CKLGFTSPRGYQILKKHGYDVYNLEGGLKAWKERGYEVER

    >gi|296109798|ref|YP_003616747.1| hypothetical protein Metin_1129 [Methanocaldococcus infernus ME]
    MIKAEKSVFDEGFEISREGKEKRELIWNNNKCVGCGICYDVCPAQAIVLGPLGAIAKGIIDTFKLNIDENKCILCGLCAS
    ACPFDALNLYINGVNSKDIERYPKIKRDIEVSQETCVLCEQCEVVCPKEAIRVHRELTERSKFVVGEININKEKCVYCGI
    CADYCPADAIILERVIPTPTNPKPVVDIRVDTERCVYCRVCEYVCPHDAIEAICYKCPLHKRIPHAKLYEDIKGETIVDK
    ELCVTCGWCSHICPVNAIKVEKPFEGEVKIDTEKCNACEACVYICPCSALEFPEAKKKGEKVTKLVVNQNLCVLCGACAK
    ACPVNAIKVERTKINFEREPISKAWRNAFNKLLKVN