Methanocaldococcus fervens AG86 uid59347

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256810000|ref|YP_003127369.1| phosphoribosylformylglycinamidine synthase II [Methanocaldococcus fervens AG86]
    MDENDLRYIEKVLGRKPNHIELAMFENLWSEHCAYRTSKKLLRMFAKTVNEKTSKHIVVGIGDDAAVIRLKDDICLAIAM
    ESHNHPSYIDPYNGAATGVGGIVRDVLSMGAKPIALLDPLRFGDIFGKEGDKVRWLVEGVVKGIGDYGNRIGVPTVGGEC
    EFDSSFDYNNLVNVVCVGLVRENEIITGKAKEPGLSLILVGSTGRDGIGGASFASKDLTEESEEERPSVQVGDAFSEKCL
    IDAVLEAIKTGKIKAMKDLGAAGLSGASSEMCYGGGVGCELYLENVVLREPLTPYEIMVSESQERMLLAVESGSEEEVIK
    IFKKYELPASVIGKTIEEKRIIAKYNGEVVVDLPLDLLCEAPLYDREAKEDLKEREDDKEKIKMPEDLNAVLLKLLESPN
    ICSKEWIYQQYDHEVQIRTVIKPGKDVAVLRIMETYPTGIALTTDCNSRYCKLNPYVGAVNAVAEAVRNLATVGAEPIAM
    LDNLNFGNPERSERFWQLAECIKGLSDAAEFFEIPVVGGNVSLYNETVIEGKEFPINPTPAIFVLGKVEDVEKVPGVLDN
    KIREGDMLIITNETKDEMGGSEYYKVIHNTEEGRVPRVDLDKEKKIYEEVREVIKEGLVSEAVDCSRGGLAVALAKMAIL
    NNIGLDVDLTTYNKNNLRDDILLFSETSGRIILAVREENKDKVLSKLSNAYVIGKVGGNKLKIKINGKDVIDLDVEEMKK
    RYYEAFPKMMGEI

    >gi|256810207|ref|YP_003127576.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus fervens AG86]
    MSPRVGVFVCYCGANINGVVDCEAVRDFAEKLDGVVVAKTYPFMCADPGQNLIKEAIKEYNLDRVVVAACTPKIHEPTFR
    NCIKEAGLSPYYLEFVNIREHCSFVHMNEPEKATKKAMELVAGAVERAKRLEDVPQKIVDVDKSCLIIGGGIAGIQAALD
    LGDQGYKVYLVEKEPSIGGRMAQLAKTFPTDDCAM
    CILAPKMVSVANHPNVELITYAEVKNVEGYIGNFEVTIEKKPRYV
    DEDVCTGCGACAAVCPIEVPNEFDLGLGTRKAIYVPFPQAVPLIYTIDMEHCIRCGLCEKACGPGAIRYDQKPEEIKLKV
    GTIICAVGYDEFDATLKEEYGYGVYDNVITTLELERMINPAGPTGGHEIRPSDGKHPHRVVFIQCVGSRDAKVGKPYCSR
    ICCMFALKNAQLIKQHDPSTEVYICYMDIRAFGKGYEEYYRRAQEQFGVKFIRGRPACVMEDPETKNLIVRVEDTLLGEI
    VEIEADLVVLSAGLSARPENPKLAKMLGLELSPDGFFKELHPKLAPVNTKVDGIAIAGVAQGPKDIPDTVAQAKGAASAV
    AIPMAQGEFRIEMIRAVVDEDVCGGCQVCAKMCPYNAISYVEKDGHLVAQVNDVACKGCGACAGACPSGAMQLRYYRDEQ
    IISFIDGVLEAHQKLES

    >gi|256810211|ref|YP_003127580.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus fervens AG86]
    MNITIQNDACLVCYACQAECPTKAIDIDNFKVCNLCMQCVNVCPNGALVEEEVEINGKTVKRVNYLAHKCEKCGNCAEAC
    PVGIKKVDDEFPYSKGHCVLCQKCIDVCPIEIISLPGIIDKPRREVKAPKDPIAVTDACVGCGVCVPECPVNAISIEDNK
    AVIDKSKCIYCSICAQTCPWNAIYVAGRIPKKRRKEVKSFKVEAEKCIYCLKCVEVCPGDMIKVDNENMIVVPPKSCPAC
    GLCVNICPVNALELDVKLSSPHPITDEGLVIVEEDYEVLKKCASVCPTEAIVVDDEKKEVKMCIVCGACTVACPTGALKL
    GKIEHNGKEYNRIEFSPYLCDKCGKCVEVCPMKTLKLADDEKLPLKGYCVMCLLCLSCAEGEKKKVLELR

    >gi|256810215|ref|YP_003127584.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanocaldococcus fervens AG86]
    MKIAVVGAGPAGRTSAMFLAKNGFDVDLFEKERIGGTCLNYGCTYITGLREMADIINNLSILKGEKIHLEEIISFKELQE
    KINKIQDRIRNKLEKETKEAGVNIKYKEFKEKYEDNYDYVVYATGKNYPTSYDGYEVLTHKDIPNLRELPENILVIGGGA
    VAAEYASIFSDFGSNVVVYTRSKILKEIKDEDIRDYLMKKIINFKIINDKEEFEKLLKNEDYTKILAIGGKGVFETDEYL
    RVKNKEKTYACGDCVINGGGNTPISRMEGRVVAQNIFNEINNKPLIKPNYELIPKSIRLSLPISYVGKQTNEYKTIRSCV
    GKGNFFKVLSGVGINKIYYENGKIVGAIAMMPCSEILPYFTQLIKGIDVYYDFIEIHPSTDIFYKEFRQ

    >gi|256810301|ref|YP_003127670.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Methanocaldococcus fervens AG86]
    MASSLWYLYEFARKKWIKKFVDAKSEESSYIPPERYRKVPPVVEFPERCISCEACKESCPAFAIELIYNESYNKKLPKID
    EGS
    CIACANCVEACPTGVLEIDKHRAETEGLFFDIPKYTNLIIDEEVCVRCGNCERACPVNVIKRKEGRYVIDRASCISC
    KECIKACPIENAIVVFDERTLKEKIEKAFEIKNKIIIGKLEVKENVIEEIPHIVDSLCITCGTCKDVCIGEIDLKEKKVV
    ECVKCGLCIEVCPTTAIRTHVPIIPKRKDICYVIDEDLCIGCRICQKVCHVNAVKISKEIKLPYIVPELCVACGACEREC
    PVGAIRAVKPEEAKEAVKRRIIEDKIIENIEEDLISFTEKYGKVMEEIEKLSLKKMKEELKRKVHEERRRIKEMKRELYD
    KKDNR

    >gi|256810519|ref|YP_003127888.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Methanocaldococcus fervens AG86]
    MRAIIVGSGAGGLTTASTIRKYNKDMEVVVITKEKEIAYSPCAIPYVIEGAIKSFDDIVMHTPEDYKKERNIDVLTETTV
    VDVDSKNNKIKCIDKDGNEFEMGYDYLVLATGAEPFIPPIEGKDLEGVFKVRSIEDGRAILKYIEENDCKKVAVVGAGAI
    GLEMAYGLKKRGLEVLVVEMAPQVLPRFLDPDMAEIVQKYLEKEGINIILSKPLEKIIGNEKVEAVCVDGKLYDADMVIM
    ATGVRPNVELAKKAGCKIGRFAIEVNEKMQTSIPNIYAVGDCVEVVDFITGEKTLSPFGTTAVRQGKVAGKNIAGVEAKF
    YPVLNSAVSKIGELEIGGTGLTAFSANLKRIPIVIGRAKALTRARYYPGGKEIEIKMIFNEDGRVVGCQIVGGERVAERI
    DAMSIAIFKGTTAEELANMEFCYAPPVSMVNEPLSLAAENALKKLGK

    >gi|256810775|ref|YP_003128144.1| selenide, water dikinase [Methanocaldococcus fervens AG86]
    MEKEGKMRLTEMVKLHGCACKLPSTELEYLVKGIVTDKDLSNKDILVGLGDDAAVIKRDGLVIAKTVDVFTPIVDDPYIQ
    GKIAACNSMSDIYAMGLLDIVGVLAIVGIPEKLPIPIVREMLKGFQDFCRENETTIVGGHTILNPWPLIGGAVTGVGKEE
    EVLTKAGAKEGDILILTKPLGTQTAMALSRIPEEFKDLIDVSEEEKEYIINKAIELMTTSNRYALMALRRAEKRVGDKIA
    NALTDITGFGILGHSNEMADNSNVLIEINLLPCIKKTPELSRLFGHALLDGYGAETAGGLLISAKKEYKDDLINELEKSN
    CYAFEVGRVVKKGEGKAVLSKDVKVIEI

    >gi|256810985|ref|YP_003128354.1| DsrE family protein [Methanocaldococcus fervens AG86]
    MIRKFKVKGLRSPSLLLDMILSDTTEGILVVETDGEEQIKDIENLLKKYNLKYEVDGNTVKIYVGEIQADKTINVVGATC
    PGPIMMVSDILSKMKIGEVLEITCGKNALTDLTEGLKGMGHEIIKVEDKGDGTYRILVKKGEKKEEKAAVTKIDEIFIIN
    TTGTGNAEKAYATFMMADVALKMNLKPTIFLMMDGASLGLKGECDKVKHPAFPKLGDMVREIQKKGVKIYV
    CEVSAKFRG
    IDENNLEEGFEIAGAPTFLNYLSKPNVRPVWL

    >gi|256810999|ref|YP_003128368.1| Peroxiredoxin [Methanocaldococcus fervens AG86]
    MCEEKMPVIGEKFPEVEVKTTHGTIKLPDYYVEKGKWFVLFSHPADFTPVCTTEFVGFQKRYDKFRELNTELIGLSIDQV
    FSHLKWIEWIKEKLNVEIEFPVIADDRGELAEKLGMISPYKGNNTVRAVFVVDNKGIIRAIIYYPQEVGRNLDEIVRLVK
    ALQISDEKGVAMPANWPENDIIGDKVIVPPASSVEEIKKRKEACEKGEIECLDWWLCYKKLE

    >gi|256811272|ref|YP_003128641.1| redox-active disulfide protein 1 [Methanocaldococcus fervens AG86]
    MSKVKIELFTSPMCPHCPAAKRVVEEVANEMADVVEVEYINVMENPQKAMEYGIMAVPTIVINGDVEFIGAPTKEALVEA
    IKKRL

    >gi|256811303|ref|YP_003128672.1| redox-active disulfide protein 2 [Methanocaldococcus fervens AG86]
    MLTPITYGEIMVVIRIFGTGCPKCQQTYENVKKAVEELGIDAEIVKVTDVNEIAEWVFVTPGVAFDDVIVFEGKVPSVEE
    VKEELKSYLEEKE

    >gi|256811313|ref|YP_003128682.1| HesB-related (seleno)protein [Methanocaldococcus fervens AG86]
    MKKVIISDEAKEFILEKLKKANEDKIVIHFDGFGCGGPKFGVAIAQPSENDKLIYDNEFKIYIDPIADQWLDEVNISLRK
    SIFGKYLKIKGSGEC

    >gi|256811432|ref|YP_003128801.1| DsrE family protein [Methanocaldococcus fervens AG86]
    MKFTVIITEAPYGKERAYSGLRFALTALLEGIDVNIFLIENGVYVAKKEQNPSEMPNYSELLKNAIELGAVVKACGPCCK
    ARGLKEEDLIEGVQLATMHDLVAFVKESDNVVTF

    >gi|256811465|ref|YP_003128834.1| methylated-DNA/protein-cysteine methyltransferase [Methanocaldococcus fervens AG86]
    MIIQIEDYFIGMIFKGNQLVKNTIPLRREEIFKFMNGYIVKNPEEEYLEIGEVILKLYFAEVDDKEAREMINYKLEVPEF
    TRKVLDIVKNIEFGKTITYGDIARKLNTSPRAVGMALKRNPLPLIIP
    CHRVVAKNSLGGYSYGLDKKKFILEREKLNKRI
    KIKN

    >gi|256811471|ref|YP_003128840.1| thioredoxin reductase [Methanocaldococcus fervens AG86]
    MIYDTIIIGGGPAGLTTGIYAMRGKLKALCIEKENAGGRIAEAGIVENYPGFEEIRGYELAEKFKTHAEKFKLPIVYDEV
    VKIETNERPFKIITKNSTYLAKTIVIATGTKPKKLNLNEDKFVGKGVSY
    CTMCDAFFYLNREVIVIGRDTPAIMSAINLK
    DIAKKVILITDKSELKAAEPIMLDKLKEAKNVEIIYNAKPLEIVGENKAEGVKILVDGKEEVIKADGIFISLGHVPNTEF
    LKDSGIELDKKGFIKTDENCKTNIDGIYAVGDVRGGVMQVAKAVGDGCVAMANVIKYLQKL