Methanobrevibacter smithii ATCC 35061 uid58827

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148642103|ref|YP_001272616.1| peptide methionine sulfoxide reductase, PMSR (protein repair; stress) [Methanobrevibacter smithii ATCC 35061]
    MKYNIKTIYVAGGCFWEIEAYISRLKGVIQTEVGYANGITHDPTYEQVASDKTKHAECVKVNYNTFETSLEEIIKEFLKI
    IQPSESTHHRLGIYWHDPKDAKSILRLVNKNPSIEAHELKGFYLAENKYQKYLEKHPEINSNIKINMNQSDNLTLLSYQV
    TKLAMNEEAFSGKYADFDEEGTYVDITNNEELFSSKDKIKNDSGYACFTKPINPDAITSLRDFSYGMVRLEIRAQKSGIH
    LGYKKRDYYEINSAALKFVYK

    >gi|148642106|ref|YP_001272619.1| NADH oxidase [Methanobrevibacter smithii ATCC 35061]
    MKVVIVGGGAGGMSTASNIRRLDKDAEITVITRDENVAYSPCAIPYVLSGKISSFDDIIMKTPEDYKEVNIDVLIKSEVT
    AVDSSKKTVTYENADGEKTIDYDKLVLATGGNPFVPPMEGVDLEGVFQIRNIEDGRKVQQWAKTSKSAVVTGAGLIGIEI
    VFALKELGLNVTLSEMMPQIVPRSLDSDMADILTGYLKMENIHVMLGEPITKLEGEDGKVKKAYFGDGSCIDADMVILAT
    GVRPELELAKMAGCDIGRWAILVNEKMETSVEDVYALGDCVESQDLILQANTISHLGTTAVRESKTLARTITGKKSNFNP
    VLNAMVSKVGKLEFGAVGLTSSFAQQNNIKPIVEKVEALTRARYYPNAKPMDIKIICDCNGRIIGCQIIAEERVAERIDT
    MTLAITQGLSCFELSNVEFAYAPPVSMVTDPLVLAVEEVSKKFN

    >gi|148642142|ref|YP_001272655.1| heterodisulfide reductase, subunit A, HdrA [Methanobrevibacter smithii ATCC 35061]
    MPEDLKVGVFICECGGNISDTVDIQKVKDSLNVEVVEQFVNLCSLNGRKIIRDAIFDHHLDRVVIAACSPISHEKTFQDY
    VQPLNPYLMDMANIREQCSWVHNDKDGATKKAITLINASIEKVKKSDAVNPIYCQTPNEVAVIGGGIAGMNAALSLAKQG
    TKVTIIESSPSIGGHMAKIGKVFSPVKIAEECGM
    CLLNPILNEVVWNENIEIITNAKVIESERRAGTYNLIVEKSPRYVD
    TEKCIACGKCAEVCEVEVPDDWNDGLSNRKAIYRPFGQSYPEAYVVDMEHCDRCGDCKRQCSMNAIRFKVKPEKIPISVG
    SIIIATGHKLFDPDLRPEYGYSRYDDVITQSELGRITGVNGPTKGKLVKSNGEIPKRVVMIQCVGSRDEKPDGHLYCSKV
    CCSVALKNANIIKHKHPETDVVICYTDMRTPSMYEKYYKHTQANGVRFIRGRPGEVVKRNGNFIVRVEDTLKREFSEIEA
    DMVVLSTAMEPSEGTKEIAEILNVGTTEDEFIKEAHPKIKPVTTDIQGTFVCGTAQDPKDITESIMQATAAASKVSEYNY
    GGIEIEPFIAEIDEEKCIVCGECVERCKFKSMSIQDDEIYIDPMSCTGCGKCLVGCKQFAITVNGNIDEKIKATIDGVLA
    KKEPGERMILVFLDNIGYTAADNIGVNRLSYPESIHIIRVLSVNRVRPRHIKHALENGADGIFIGEFPGDLMYDEVERKI
    EKVKERIREVNQNPDRITFSKVYIPYYSGLANKLNDFDKKIKELNESE

    >gi|148642366|ref|YP_001272879.1| polyferredoxin, iron-sulfur binding [Methanobrevibacter smithii ATCC 35061]
    MNISFDKQISSLEREILLKSVEIHDSGDDFQFELNKFFSQKEIIAIAPRCIRCNMCVDQCPVDAIEPANIFKIAKITHDC
    VKCEICVQTCPVSAIKLIDNKVSYNHDEGDEAIEYNLASISRPHRVVRMNDISIDYSDLANYDNCAKFCPTDAFTLEFKS
    YFEELGIDVDIELEDDVLYPVINKKL
    CIGCGACVQFCENDSVKLDRTIGPIVHTKNLEINQDECVNCYLCEENCPVEAIW
    LDEEKVVLNNDKCIRCINCTSHCPVGALNFVEID

    >gi|148642371|ref|YP_001272884.1| polyferredoxin, iron-sulfur binding [Methanobrevibacter smithii ATCC 35061]
    MSSLMWYIYDFARKAWAQGFTNAKTSPEIVEKPSRFRNFPNVIKEYCIGCGACISSCPSPNAIKLVRDEDDETKEGVTYP
    IINKSACIRCGFCAEVCPTEPKTLECGENHLLKPEFNIIPSKRQFIIDDYLCIRCKKCMKQCPVGAIHVEDDGKVVVNPF
    KCISCGECLDVCPVNGAMKGVFVDNIQDQKELIAQVVTFLEKYINNKEEDLRSLKKDRLLQYNFPLSDIFDKALEIISDE
    EIALEILTNAINRLKIRIIDWDSETCKKCQMCIPDCPTKAISFDEKNDTIVRNENKCLRCSICYQSCPFSTIKYFISKFS
    LEEDENGEKIVNVTVKASNLNEEVVMG

    >gi|148642400|ref|YP_001272913.1| thioredoxin reductase (NADPH), TrxB [Methanobrevibacter smithii ATCC 35061]
    MKTYDIIIVGAGPGGLTAGIYAGRQGTKTLILDKGLAGGIGREVPLMENYPGFDTISGFELVEKMKLQCMKYIELHENEI
    VKNIEKNNDNFLVTTHKDEYCGKTIILATGSSHKHLEIPGEEEYLGKGVSY
    CATCDGLFFKDKDAIMIGGGNSALQEAIF
    LDNVGCNVTIIHRRDELRAQQYLQKEIKERNIDVIYDTTVEEIKGNALVNSVILKNVKTNEYSEFKTQGVFVGIGYKPHN
    ELAKKLNVELSESGEIITDKHQRTNIENVYSAGDICGGLRQWIVACGEGAIAATSAYEDIHNHK

    >gi|148642610|ref|YP_001273123.1| protein disulfide-isomerase, thioredoxin-related [Methanobrevibacter smithii ATCC 35061]
    MIYYNTFMKKCSLYFIIFIIIVIIALSGWFSINGDFEKEEASESEFNIIDTAGSLSEALQKAKTSDKQVFAVFESDTCTY
    CHQLRQNTLNDAQVMEKLNESYVVVIINVNDSPEIASKYNVYSTPTMLILDSEGNELKSIEGYYGPEDLIKMI

    >gi|148642642|ref|YP_001273155.1| peptide methionine sulfoxide reductase, PMSR [Methanobrevibacter smithii ATCC 35061]
    MFFNIIYYFMKKSPVIGGFGMSLENINNKIQFNKENLKTIYLAGGCFWGVETYISRILGVYETEVGYANGNTKNPTYEEV
    CNFDTKHAECVKVTYSPDFISLKELLEEFFKIIDPIAINRQGPDIGTQYRTGIYYTDIRDKQIAEMFIKEKQLNYSKKIA
    VEVMPLTYFYPAETYHQKYLEKNPNGYCHVDLSKLPEIDESLEKLKIKENIRKLDPTEYEVTQNSATEIPFSGKYNDFNE
    KGLYVDVVSGEPLFTSHDKFNSGCGWPSFSKPISEDNIKKIKDTSHNMIRTEVKSKKADSHLGHVFDDGPSELGGMRY
    CI
    NSAALKFIAFEDLEKEGYGEYIKYFEK

    >gi|148642697|ref|YP_001273210.1| dihydrolipoamide dehydrogenase [Methanobrevibacter smithii ATCC 35061]
    MKNIVIGSGPAGRLGSLELGKLGKEVTLIEKNHIAGTCLNEGCMVICALTDITKFIENNNKFNSYGFIKSQLDISYEKIV
    EKITETQKMLRKINEEENKGAGNNIVYGEAEINGSQVEVNGESFDWDNLLIATGARPFIPDIPGSQYGLTNRDILKIDKV
    PEKLNIVGGGIIAVEVANIYSTLGSEVNIIARSKALKEIDSDIKDYIFKNLLSEINILEETDVVECKKNKVITNKNEELE
    GVPFFATGRVANSEIVRDIVELNPDNTIKVNEMMETTKEHVYAAGDVTGGYQLTPVARMEGITAARNMANYPNKVVYHAI
    PQTLSLNTEVSFVEDEKNNCSEEDKVDIGIPGIAGPGAFWKILSGDTGYTKISFDKKQNKIKKINSISPSSVSDIAYLSY
    LMRINSPLDEYGDFLEIHPSTDANYKIIKSMWL

    >gi|148642898|ref|YP_001273411.1| putative thioredoxin/glutaredoxin [Methanobrevibacter smithii ATCC 35061]
    MVVKVEVFTSDSCPHCPAAVNVANEAKEVLGDAADIIVCNIASEENRQKAIGLGIMAVPTIAINDEVAFVGAPALDELVN
    KVKSLI

    >gi|148643021|ref|YP_001273534.1| heavy-metal cation transporting ATPase [Methanobrevibacter smithii ATCC 35061]
    MATEEKTINVVGMHCPSCVAAVELSIKDLDGVEDAKADLESNTAKVTFDSDKVSDSDLAEAVKEAGFKVE

    >gi|148643058|ref|YP_001273571.1| polyferredoxin, MvhB [Methanobrevibacter smithii ATCC 35061]
    MIVFNEDGCIRCGACEGTCPTSAIDVTPTSIIHCDTCGGEPKCADVCPEGALKVETYSIAEGAEEQIRLVFNSTLCNSCG
    KCEEACPQDTIKLTGNDLMEVEGF
    CVMCQKCVDICPVDVIGIPGIVEPKGEVIDLDGKGSIYINDCVGCGTCVDPCPVSA
    ITLDEIGGTISIADDVCIKCGLCSQTCPWNAVFIAEKKPAKRAKTINAFDLELSKCIGCNTCVEACPGDFIKANSANLSV
    LIPDACAACQLCVKLCPTDALSMDVEWAEGVPADTEGLGYDAEKCDFVGACANKCPTEAIRVVTKTGMLCPALEETDAEP
    SFASCIRCGACAAVCSNDALSVGSIEKVIDGETVTRDRIEFNPYKCNECGDCIEACPYNMLHATGNEKFPIMGFCTLCGQ
    CIDACPKHALYDV

    >gi|148643213|ref|YP_001273726.1| cation transporter HAD ATPase [Methanobrevibacter smithii ATCC 35061]
    MAKLKEMDLPIEGMHCASCVLSLNKTFEKVEGVESVDADLASNKLHLTVNPKKLPFDEIETLVKNLGFELHTDEVTLKLN
    GMH
    CASCVMNVENFLIRLDGIFDVKADLTSQTARINYDKTKVTVKDMEEVINSLGFEVLGIDGQLEINEDEIYKNDLKDK
    RNRIIVGFAASAVLMALMYIHWHPFGLSMGITSLIISILPFLYVSLPTLKAGFNGLVHKNLNMDVMYSMGITVAYISSIL
    GTFNIVLDHSFMFYETAIMLPSFLLIGRYLEAKAKKKTSDSIRELIGLQPTAATLIELDSNGNIVSQKEVNIKEIQIGDI
    LLVRPGDKIPVDGEVIGGHSYVDESMINGEPIPKAKRDGEEVFAGTINQDGVLHIKAKKIGSKTVLSNIIRLVEKAQSSR
    PPVQKLANTAVSYFIPTILTIAVVVFLLWYFVFDSTLLFALTTLISILVVACPCALGLATPTAVTVGVGRAAEFGILIKN
    GDTLENAGKIDVAAFDKTGTITEGQPEVDDVICYGISENELVELAASVEKNSNHPIAKAIVRKASDMNLELIRTSSFENI
    TGKGLKAQVNDKDILAGNKKLLESQDIEIPQSVLEEYGRLEDLSKTIILIGVDREIKGILSLSDKIKANSKRTIEELHKM
    GIETYMLTGDNKKTASTVASAVGIDNVCAGVLPENKLDIVKNLQKEDKTVLFVGDGINDAPALTQANIGVAMGNGTDIAM
    ESGDIVVMEGDLENVVAAVQFSKKVMTRIKENLFWAFAYNVILIPLAAGALYAGFGIMFMPEWSALAMALSSVTVISLSL
    ALKGYVPAIKKETKS

    >gi|148643245|ref|YP_001273758.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Methanobrevibacter smithii ATCC 35061]
    MIYTTCYDSPLGKLTLAGKNNKLIGLWIEGQKHFFGNFKDKTKKNDDLAIFRKTEKWLDSYFNGENPSIENLDLNLQGTD
    FRLKVWKILEGIAYGEVVTYGDIAKKISYDMSSQAVGGAVGHNPISIIVP
    CHRVVGFDGKLTGYAGGLENKVKLLELEGV
    KIRDLKVIF

    >gi|148643396|ref|YP_001273909.1| heterodisulfide reductase, subunit A, HdrA [Methanobrevibacter smithii ATCC 35061]
    MAEEKRDNNEELRIGVYVCHCGVNVGGVVDCPDVAEYAGNLPDVVVAKDYKYMCSDPGQLMIQEDIKEHNLNRVVVAACS
    PRLHEPTFRRCVEEAGLNKFLFEFANLREQDSWVHMSEPEAATEKAKDLTRMAVAKARLLEPLEATKVAVDNKALVIGGG
    VCGIQTALDLGDMGFKTYMVERHPTIGGRMGQLDKTFPTLDCSM
    CILAPKMVDVSKHENIELITYAEVKQVDGYIGNFHV
    TVGKKARYVIEEDCTGCGSCVEACPIEIPNYYDEGVGMVKAAYIPFPQAVPLCATIDKDYCIECMLCDQACERGAIDHNQ
    QPSEIKLDVGTIIAATGYDPFDPSGIYQYGYGRYSNVITGMEIERMINASGPTGGHVVKPSDGKEPERVAFIHCVGSRDE
    QIGKPYCSRVCCMYSMKNAQLCIDHEPDTEVTCYYMDIRAFGKGYEEFYKTSQEKYGIEFIRGKPAQIFENDDLTLTIRA
    EDTLLGKVTEYTYDLVVLSVGLEHPEGSEELRQTLGVSKSSDGFYMEAHPKLRPVDTLTDGVYIAGVAQGPKDIPDSVAQ
    GSAAASRAAIPMAKGQVEIEPIIACTDDVICGACEVCVELCPYGAISITGDDNAAHAEINAALCKGCGTCVGACPSGAMD
    QQHFKTDQIMAQISAALEDVGK

    >gi|148643469|ref|YP_001273982.1| tungsten formylmethanofuran dehydrogenase, subunit F, FwdF [Methanobrevibacter smithii ATCC 35061]
    MIKNKKEAIDNNFAITRAAEEVRKLSFNDQICLGCGVCESTCPVEAITLNPIAIDARHRRSNDVYFSGHKKIAQNFHAEF
    DVQKISIDENKCVLCGMCSGLCPIDALVLTIDDVPISEIEAYPHYNSYSKIDDDKCIYCKRCETACPQDAITVMRKLPER
    QNLVSGEISVSDDDCVY
    CGICQELCPAEAIVVDNTTGQESIVIDKDKCVYCLVCKRACPVDAISAVCRACSYGEYDFKAE
    DEVTTGSAVIDDELCVYCGWCEGVCPTDAVETNKPFKGTLEIDQEACQTCGACVDTCPCDALAFPVSTAPGQRLDRITKH
    DQYCIRCKACAKVCPNGAITVTRTEIDHTPIKSVTWLDAFDAIKN

    >gi|148643520|ref|YP_001274033.1| energy-converting hydrogenase B, subunit K, EhbK [Methanobrevibacter smithii ATCC 35061]
    MIIFNTDDCIKCEACEGICPSNAIKVQPNNIIHCDTCGDSPKCAEICPNDALKVDFLTLEEGGAQQARLIFNGLKCDQCG
    K
    CVETCPQNTITLTNNPKIPLEGFCVMCQQCVEICPLDYVGIEGIKDPNHRELNIEGPIYIENCVGCGTCIEECPVQAIS
    LNELGEPIEINSEICIKCGVCSQTCPWNAVFISEKIPTKRTKEITEFKLNESSCIGCKTCVEICPGDFIKFNTNNLTITL
    PKMCAA
    CGLCEKMCSVNAISLNVKLHDATPCTEEGVVCDAEKCDHIGACAMKCPTQAIHVVTKTGMSVPEQIKSDEDPLF
    KSCIRCGACASSCPNNALTLDTEFEINKNGTLIKRPRIQYNPSKCDQCGDCVNSCPYNMLKTTDNPKLPIAGFCTLCGQC
    IETCPEKALSYK