Methanobrevibacter ruminantium M1 uid45857

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|288559375|ref|YP_003422861.1| CoB--CoM heterodisulfide reductase subunit A HdrA [Methanobrevibacter ruminantium M1]
    MAEEINNEEIRVGVYVCHCGVNVGGVVNCPEVAAYAETLPNVVIAKDYKYMCSDPGQSLIQEDIKEHNLNRIVVAACSPR
    LHEPTFRRCVEEAGLNKFLFEFANLREQDSWVHMTQPEEATAKAKDLTRMAVAKARLLEPLEASKVAVDKKCLVIGGGVA
    GIQSALDLADMGFKTYMVERNPTIGGRMGQLDKTFPTLDCSM
    CILAPKMVDTSKHENIELITYAEVKEVDGYIGNFTVTV
    EKKPRYVKEDDCTGCGQCQEVCPIEIPNYYDEGVGMVKAAYIPFPQAVPLCATIDKNYCIDCGLCETVCGPDAIDRDMEP
    EEIELHVGTIIAATGYDPYDPTEKYEYGYGRYTNVITAMEIERMINASGPTGGHVQKPSDGKEPKRVAFIHCVGSRDEQI
    GKSYCSRVCCMYSMKNAQLCIDHEPDTEVTCYYMDIRSFGKGFEEFYKTSQEKYGIEFIRGRPAEILENDDLTLTVRAED
    TLLGKVTEYTYDLVVLSVGLEPPKGSNELRQTLGLSRTTDGFYMEAHPKLRPVDTLTDGVYIAGVAQGPKDIPDAVAQGS
    AAASRASIPMAKGEVEIEPITADTDTTVCGACEVCVELCPFGAVSIEGEGADKHAAINVALCKGCGTCVGACPSGAMNQN
    HFKTEQIMAQIAAALEDVAK

    >gi|288559441|ref|YP_003422927.1| protein disulfide-isomerase thioredoxin-related protein [Methanobrevibacter ruminantium M1]
    MGKFKFIFILVLALFLICGIAAVVDAPDSFDGSLNLIPVSDSSVSQSDSSVNQSDCENGTCSVDLNKSEDNSSKETSDDE
    IDYDSKYYDDSLIDGLYFCNDLEHAFKDAKQHHKNVMIIFDGAA
    CIYCEYLKDEGLTDSDIQKEINENDILLMTYTSDSP
    ELSQKLEIYGTPTTVIFDENGTELGRIEGYESPEQFLSELKEYNGK

    >gi|288559463|ref|YP_003422949.1| copper ion binding protein [Methanobrevibacter ruminantium M1]
    MAEKELNVVGMHCPSCVMAVELSMKDLNGVDDAKASLDTNSVTVEYDPDKITDADLVGAVKEAGFDVE

    >gi|288559464|ref|YP_003422950.1| heavy metal translocating P-type ATPase [Methanobrevibacter ruminantium M1]
    MAQKELDIPVDGMHCSSCSLLVEKSLGKLDEVESINVDLNTNKAHMVLKDNLSPETIDKTVESVGFTVPKEEVVIQIAGM
    H
    CASCVNNVEKFLPRVDGVVEANANLSNQKVTITYYRDMLNLKEIQKTIEMLGFEYIGLDGELDIMDEEERYQKDLRGKL
    YRIIVGLVFAGILMAIMHFHITIPPLTMGQLSLIIAIFPFCYVSMPILKAGWNSFKHKNLDMDVMYSMGILVAFVSSVLG
    TFNIILDSSFMFYESAVMLPSFLTIGRYLEARAKRKTSSSIKELIGLQPKTATLITSDEEGNSIEKEIDIEDINIGDILL
    VKPGEKIPADSIVVDGESYVDEAMITGEPVPKLKKEGIDVFSGTINQDGALKIEAQKIGSETVLSQIIQLVEKAQGSKPP
    VQRLANKIVSWFIPVILTIAIVVFCLWYFVAGAGLLFSLTCLISVLVVACPCSLGLATPTAVTVGVGRAAEYGILIKNGE
    TLESSKDVDVCVFDKTGTITEGKPEVADIETFDMAGDKFLQVLSSVENNSNHPIAKSILNRFKSDNLKLTEEGKDDLALL
    EVSDFENITGKGLKANVVVDENNSSVLAGNLKLMESEGVEVTDEVLDKFNTFVSEAKTTIVMAIDGEIKGIITLMDKIKD
    NSKSAIDELHKMGIETYMLTGDNEKTASTVANEVGIDNVIANVLPNDKLDKVQELQKEGKRVLFVGDGINDAPALSQADV
    GVAMGNGTDIAMESGDIVIMEGDLENVVASIQFSKKVMTRIKENLFWAFAYNMLLVPAAAGLLFLLFGIVFKPEWAGLAM
    ALSSVTVISLSLLLKRYVPPIKRNKV

    >gi|288559729|ref|YP_003423215.1| glutathione-disulfide reductase Gor1 [Methanobrevibacter ruminantium M1]
    MKETKKIKNIVIGAGPAGRLASFELGKLGEETLLIEKKYIAGTCLNEGCMVVCALTDISRFWKNCQRFSEMGLVNGLLEL
    NYNSICENIKKTQKFLRKLNQEENESVSNKVLYGEASVEVDEDEKIIVTVKLDNDNELQKEEYKGKETLSFEAENLLIAT
    GARPFIPNIPGAEYALTSSDVINLDEVPPKLNIVGGGIIATELSNIFSSFGSEVKIIARSEILKDLEPEIKSYVVKKIIN
    DVEIHENTNVLKINEDSIETDNGEFEGKTLIATGRVPNSEILKGLVDLNEDGSIKVNEFFQTSKPHIYAAGDVTGGITLT
    PYARKEGISAARNMAGYLNKFEEMIVPQSLTLDLDVSFTQKTDKEADPDKIEDVIIPGLGGPHAFWRILRGETGLTKISL
    NTETDEIVRASQISPSSIDDTAYLAFLMNLGIKKEAFDDFLEVHPSTDAYYKILKIM

    >gi|288560215|ref|YP_003423701.1| NADH oxidase Nox [Methanobrevibacter ruminantium M1]
    MKVVIVGGGAGGISTASNLRKLDEEVEIVVLTRDNQVSYSPCAIPYVLSDRIHSFDDIVMRTVDDYKAKNIDVMLETEVT
    GVDSAKKQITYSKNGVVQTMNYDKLVLATGGSPFVPPMKGVDLDGVFKIRTLDDGKQVKEWAENCKSALVTGAGLIGIEI
    AYAFKKMGLKVTLCEMLPQIVPRSLDPDMAKILTDYLIEEGIDVVLGQPITELKGEDGKVKKAVFEDGTEADADMVILAT
    GVRAELNLAKMAGCDCGRWAILVNDRMATTVPDVYAVGDCVESYSAILRSNTVSQLGTTAVRQAKTLAQTLAGKRSRFNP
    VLNSMVSKVGKLEFGAVGLTRSFAQQNSIKAVVGKVEALTRARYYPNAKPMNVKVICDADGTIIGCQIIAEERVAERIDT
    MTLAITQELTCFELSNMEFAYAPPVSMVTDPLVIAVEEVSKKFN

    >gi|288560633|ref|YP_003424119.1| glutathione-disulfide reductase Gor2 [Methanobrevibacter ruminantium M1]
    MDYDVIYIGSGNASWQGARFLRKEGLKILIIEKSLYGGTCANRGCNSKALLDAPYEIKAFADNFEGYGKSGNFEVDWPAL
    MKLKRKRIANMAPFLDGKYKEYDLDVAHGEGYIVDEHTVRVGDKTFTTDKIVICTGLKPIIPDIKGKEYLHDSTDFLDIE
    ELPKHAIIIGGGFVGMEFASILAEAGLEADVIIRGNMALKFFHQPYVQNVIEILKEKNIRFHFNETVNEVIKDDSVVIEN
    PEERVNIFENAQNTDDDLRDPDAKVDNKAYENAFTVNCDSGLSLTGDYVIAAMGRTANVDTIGLENVGLDYTKAGIKVNN
    YLQTAVPNIYACGDIADTGIAKLVTVAIHQSKYLGKALLGDAEEIVYPVVPAVAYTIPRIATVGVPAYIAEQSDEYDVHR
    IRYGKSYSLELKNDTRSEAKVIVDKDLNIVGAEIYAADAENVANMFTFIINQKITLEELDNMIYAFPSSSSVCLYKLHNI
    HYKF

    >gi|288560681|ref|YP_003424167.1| thioredoxin-disulfide reductase TrxB [Methanobrevibacter ruminantium M1]
    MIFMENYDIIIVGAGPAGLTAGMYAGRQNSKTLIIDRGFAGGLGLEVPLMQNYPGFDLISGMELIQKMKAQTENYCEIKE
    NETIQSIEKTEDGFLLKTRTSPLLMSEESDEIREFKAKAIILATGASHRHLNVPGEAEFLGRGVAY
    CATCDGMFFIDRTV
    LMVGGGNSAAQEALYLKNLGCNVKLVHRRDQLRCEHHLQKALEEKEIEVIWNATVEEIKGDMVVESVRLNRNGQEEDYKT
    DGVFIAIGDDPSNEIAKELGIDLDEDGYIITDKRQATSVEHVYSAGDITGGVKQWVVACGEGAVAAISAYNDLNL

    >gi|288560831|ref|YP_003424317.1| 6-O-methylguanine DNA methyltransferase Ogt [Methanobrevibacter ruminantium M1]
    MTLFKYIITSSPIGEITIIWRKKPQFQIEEIIISNPNQTSSQIAKEKYEKEGELAINKKSKQLNKVLREMENYFNEKDYK
    FSLKYLNLDKLKPFQRAVLEAEFKTEKGTVNTYKDLAKEIGSPKAYRAVGSALAKNPFPIIIP
    CHRTVKGDRTIGGFSGF
    AGGLESKKTLLELDGLMIQGKKIVGDSPIISLDKTSQTKLV

    >gi|288560934|ref|YP_003424420.1| redox-active disulfide protein [Methanobrevibacter ruminantium M1]
    MVYKVEVFTSPTCPHCPGAVRLVEKAKEELGDALDVTIYNTAEAEAMEIARKYHIMYVPTIIIDGEIKFQGAPSYDELMA
    ELK

    >gi|288561161|ref|YP_003424647.1| methyl viologen-reducing hydrogenase beta subunit MvhB [Methanobrevibacter ruminantium M1]
    MIVFNEDSCIKCGACEGVCPTAAIEVGDHIVYCDTCSEEPKCAEVCTKGALQVDDIAIDEEGNTQVRLIFNKTKCDECGD
    CVDACPSKTLKLDPEDSQLLKGFCVMCQKCVDICPVDVIGVPGIKEPASRVIEPEGAVYIDDCKG
    CGVCVAECPVDAITL
    SAYGEPIEVDEDKCIQCGVCSQSCPWNAIFIAGNAKPAKRSKVMKSFTLDADACIGCNSCVDACPGDFISPKSDLTVALP
    EACAACGLCVNVCPVDAIDLDVEYGASKFDSTEGICWDGEKCLYDGGCALKCPTEAIRVVTKRGMEVPSRQKDMGEQSFI
    MCVRCGACANVCPNDALQLDYVDKEIDGETVMRDRIIFNPSKCDECGECIDACPYDMLHKAYKVNLPIAGFCTLCEQCLA
    KCTPEALSLK

    >gi|288561191|ref|YP_003424677.1| glutathione peroxidase GpxA [Methanobrevibacter ruminantium M1]
    MSIYDFEVKDINGNMVSLKEYEGQVLLIVNSATECGFTPQYNELTQIFDELNEEGFTILDFPCNQFGKQAPGTGEEIAEA
    CRATFLVQYPIFEKIEVNGENEEPLYTYLKSEQPFVDITGEDAERLKGILESINPDYMDSNDIKWNFTKFLVDREGNVVA
    RFEPTQSLDDVKAQIKELL

    >gi|288561194|ref|YP_003424680.1| hypothetical protein mru_1938 [Methanobrevibacter ruminantium M1]
    MLFIYYPRCSTCQKAKKWLDENGFDYDEQHIVDDNPDYEQLKALYEKSGLPLKRFFNTSGKIYREMQLKDKLADMDEEEQ
    LNLLATNGMLVKRPIIETEDTCLTGFRQKEWEEKLK