Metallosphaera sedula DSM 5348 uid58717

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|146302938|ref|YP_001190254.1| glutaredoxin-like domain-containing protein [Metallosphaera sedula DSM 5348]
    MEEEYAELFTEEVKNALVDALRDMKGEVEAHVFIDSSNPNCQYCGVTEKFMEFVRQASPKGQDGDYLLKVKVHDLAKDKE
    SFKKYEVSRVPTVAFLEGKIRWTGAPLGEEIRALVETIVRLSQGESGLSPETVNAIREKLNGKVKVEVMVTPS
    CPYCPYA
    ALLAHMVAYEACKAEKCNVISDVVESYENPDIAEKYQVMSVPTVAVNESVEFIGVPQEENFLNTLLEKQM

    >gi|146303141|ref|YP_001190457.1| rhodanese domain-containing protein [Metallosphaera sedula DSM 5348]
    MKYLISAPKLLEDLHDYKVVEVTFYDDSYVEWHIPNAIRLPWRYLRHPVKRDFATREILEKRLGELGISHEDPLVLYSDF
    NNRYAFYAFWILRAFGHREMSVLDGGKVAWEIKEFPRETEVRSRPACKYEALEPDWSQRIMVWELLPKINRGEKFQLLDV
    RYREEYVGEASTPPEHPNEESQVTGHIPGAVNVPWNKFFDPITEELLPPDKLEISVSRDDTVVY
    CRTGARASLVWFYLKY
    LLNIPRVRLYDGSWSEWGNMVGVPVER

    >gi|146303144|ref|YP_001190460.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Metallosphaera sedula DSM 5348]
    MVYISIFLIKPMPEIGQIAPDVELVDTDLKKVKISDFRGKVVVLAFYPGAFTSVCTKEMCTFRDSMAKFNEVNAVVLGIS
    VDPPFSNKAFKEANKLNFTILSDYKRDAVKAYGVDMEFLPLPGYVLAKRAVFILDKNGKIVYKWVGKELANEPNYAEIEE
    VVRKLK

    >gi|146303157|ref|YP_001190473.1| protein of unknown function DUF395, YeeE/YedE [Metallosphaera sedula DSM 5348]
    MATPSMILQPVFSESWALIFGLFGLSGFILGWVAQRGNYCFVNAMTSIFTTKSFERFGALLILFGLTALGTGLLVAFGLI
    PPVDQYFNNYFAGWYILVGSFIFGFGAALAGGCNLSMLYRASSGYVQNWIELFGMMIGTYIFAVAIWPFQSYTMQSGILS
    TSSGGYVEYLPYVLFHSVSNMSVYITTMIVALPLLFLGIYLQMRTRSKWDKSVSMKGPGLSAVGMKALPGLPGPSSPSIP
    SGLRLRQEAKDMLLLRKPYGTNLSTVILALDMIFVFIVGAGYTFNYLVITSSDGGRFFEYILMPLGINLFTNTPWFNSSL
    PIVDPSTLMVVMLCVGAFSASFLSGDFKIRIPKDRKRLAIGFVGGMLVGIGVRMALG
    CNVGLMWTNFGQLGYDGYIFLGG
    MLAGIYLAVKVQEKL

    >gi|146303354|ref|YP_001190670.1| putative selenoprotein [Metallosphaera sedula DSM 5348]
    MHSVKIVYCRPCGYLDRALEVSREVLSYFDDVKVELEQGKNGIFDVYVDGELKLSRYQLKRFPEVEEVLKEIANKKQVA

    >gi|146303415|ref|YP_001190731.1| thioredoxin reductase (NADPH) [Metallosphaera sedula DSM 5348]
    MSLIPRSTNINPNEKFDTIIIGLGPAAYSAALYAARYMLKTLVIGETPGGQLTEAGEVDDYLGLIGVQASEMIKLFNAHV
    EKYKVPVLMDRVESFKREGEEYVVKTKRKGEFRASTLIVAVGTKRRKLNVPGENEFIGRGVSY
    CSVCDAPLFKNRPVVVV
    GGGNSALDGAELLSRYATKVYLVHRREEFRAQPIIVKLVKEKPNVELILNSVVKEIKGDKLVRKVVVQNMKTGEVREIDA
    NGIFVEIGFEPPTEFAKINGLEVDEQGYIKVDDWTRTNLPGVFAAGDCTNKWIGFRQVATSTAMGAVAAHSAYNYLNERK
    GKT

    >gi|146303495|ref|YP_001190811.1| methionine sulfoxide reductase A [Metallosphaera sedula DSM 5348]
    MTELATLGGGCFWCTEAVFSRVKGVVKVEPGYAGGWVPNPTYEQVCSDTTGHAEVVQIEFDPNVITYRELLEIFFEIHDP
    TTKDRQGNDVGSQYRSIILYHNEQQRRIALEVIDELNRTRFNGRIVTEVVPYTAFYRAEDYHFRFYDRNKDYPYCRYVIS
    PKVKKLMEHFPSMVKMRES

    >gi|146303540|ref|YP_001190856.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Metallosphaera sedula DSM 5348]
    MVDVGQPAPDFEAEGSTGKVSLSSLRGKKVVLYFYPKSFTPGCTREIQRFVELYDEFIKAGAEVIGVSVDSVSTQKRFSE
    KYGAKFPVVSDHEKKISSSYGVLNEKGTSAQRVTFVIDAQGVIRAVLRNLKKAEDHADRALEEVKKI

    >gi|146303559|ref|YP_001190875.1| thioredoxin [Metallosphaera sedula DSM 5348]
    MSVENDPELEALIRKKIKQMMKQGKDMEKEQRELIAHLDSRNFDEFIRKNKVAVVDFWAEWCAPCLILAPIIEELAMDYP
    QVGFGKLNSDENQDIAGRYGVMSLPTVIFFKNGEPVDEVIGAVPREELEIRLKSLLGD

    >gi|146303563|ref|YP_001190879.1| rhodanese domain-containing protein [Metallosphaera sedula DSM 5348]
    MQIIEQYSTPFYKNIIDMPPSMVRKLWKRSNILVLDIRTPQEYVEHHIPGSLLIPMDYLEVLQEYFSDKEVAVICEHGNR
    ARYATYGMPHLYKKKAIYMIGGIVGWMSMGYEVVSGMDENGTKWEQWLDEKLK

    >gi|146303570|ref|YP_001190886.1| hypothetical protein Msed_0787 [Metallosphaera sedula DSM 5348]
    MNRLNDSTSAFLRESAEQEIDWFPWSDEAFQRARQEDKPVLVDVGAVWCHWCHVMDRETYSRHDVAEIVNKHFVAVKVDR
    DEMPELDRKLQRAVSSITGESGWPLTVFMTPEGEVFFGGTFFPPEDSYGRVGMKRLLLEIVRLWTQDRERLKRSALSLTD
    YVPSTSSPLEFEVVDTAFSSIVSTFDIEQGGLSGNMKFPHPMVDQFLTAYSFWTGDHVGIKLSTFTLKRMFQGGIFDQLG
    GGFHRYAVDREWNVPHFEKLLIDNAELLEDYFVNYLASRDPQLREALDMTSEFALRDMWIGEGFASSLDADVEGKEGGFY
    TWDWDELLSHSGEWKSLVEKTFTLVGEGALEGGVIRARDDLGEIAKMMGMEIGTFLGNLRKARETLRIHRDSTRKRPFRD
    ENLYTYPNCRMADSLLASSLLTGRGRDEALKVSSKLSGRVTRRLQGGGEGLLEDYSSALLLALRAYEVTGNLKFRDLSLE
    LGREVLGFMTPSGFVEKKGSSEVPNMDTPNESPNSLALRGLLSLSLVDDQIKVPESVISSILGDYMQGPPFYAGSILSAG
    AILKGMAHIVVVDADERAKLLHRESMLVYHPFKVVELVKEEDRDLVVPLIRSMINQGEGSRAFVCVGNTCSMPVKEPEKI
    KLLLKSKLPQ

    >gi|146303719|ref|YP_001191035.1| hypothetical protein Msed_0939 [Metallosphaera sedula DSM 5348]
    MRFREWNEIIKDKSPLKVIYFWTDWCEECGAQYKELSKIEDWEGFGYASVNADERPDIAIRYSPQIYPSLAIVTEGNVVG
    GLYGFSEEWKIRETLLMALDLSLGGGKLVSPKFNRDLRKVPRSNYVLQNERHENILNDIRSKCISFFDIYQGGFEKEPKY
    YLPNVLRFLLRFKDSYSMEIVKYTLDAVIYNLWDNGFYAFSKTYDWKNPYKVKLLDLNAEMIIALLETFAKTKDTYYLDY
    AVETGKWLMRSKKGDFYPIAETSQGMVGKPLLTVNSLIGEAMFYLYEFTNDESFRDEAERLSSLLKPSHVIGDGNPFLLD
    LAYLIRFLSSLGKGKEVVKVAFDQFFGGDAFYDVSLPHALSNGIGRFKLITDNSILGQGLVKLGLMEPAKQIANYFSTRY
    WNFTYFNQADFGLLVWMLNEHT

    >gi|146303851|ref|YP_001191167.1| putative peroxiredoxin [Metallosphaera sedula DSM 5348]
    MEMSERIPLIGEKFPELEVDTTQGRIKLPDAFSGKWFVIFSHPGDFTPVCTTEFVSFAKRYQEFKNLNTELIGLSVDSNI
    SHIEWVNWIEQNLKVEIPFPIIADPMGNVAKKLGMLHAESSTATVRAVFIVDPKGIVRLIMYYPLEIGRNISEILRSIKA
    LQLVDKTGNVIPANWPNNEIIGDNVLNPPPRTVKDSRLRLQQFKGFAWWLTYKEVDKKEVEEAKKLLSQR

    >gi|146303863|ref|YP_001191179.1| dihydrolipoamide dehydrogenase [Metallosphaera sedula DSM 5348]
    MTDFDAIILGGGGAGYTTAFELSRGGMKVLMLDPKGVLGGNCLYEGCIPSKTYWYGARQLETAKRVPFMKAEISFPKLVD
    WKDQVQERRFRQHDDEIREHESLTFLAKSGIIVDQNHVKVEDRVYSTKYLVIATGADPVIPKGYEAGITTHELLMPKTRI
    REVPRKFAIVGGGYIGVEMASIFARLGSEVTLFASHLIKEVSQEVQSLLERELINAGVKIVKERSTGVLKENGKVVLTEK
    GKYQGFDEVLVAVGRRPNTSSVNGIPLGKKGEIETTPGMRSAIENIYAPGDVNGKFMLFHVAVLEGWVTAQNILEGNREV
    VEMDYNAVPFAVYTFPQVAWVGLWKEQAIARGFDVETRRYDLSLDSRAQIDGFAEGWMEVVIERGSQRILGAQVVGEDAD
    MLIGELALAVGERLTSYELARISQPHPTQLEQITSLMRRVRRAS

    >gi|146303925|ref|YP_001191241.1| protein of unknown function DUF395, YeeE/YedE [Metallosphaera sedula DSM 5348]
    MITFTAPMWVGILIGFIIGAAAEAWGIANPETLIRLAKWEDRLFVICIALGLAISTPVLFGLYALGVGFHFSPKPLYLVG
    VGLGGVLFGAGLAIAGYFPGSIWMALGEGRRDAIYALLGALLGAASWTALYQTSVGQWLVSTLNFGSLVIGGKHVSTFVI
    QPFQGLTPVDLFGISLVYAVGLFLVAYYLPRYKGGQRSCIRENLERRNTPVEVQKHLDTAIYLTDGGLPYSQTSLAKKVN
    EYYATESNVTRWFMVSIAGIVGLTVVLEMFLHQIFGESTTYSWIVGQLFMPSFKYSQIVFKGIGWEPFSDIGTLMGAFFS
    AVFITRRFTSFRNIIPPSWAHRFGTNEAVRFVGSFLGGYLMLFGARMAGG
    CASGHILSGDMQMALSGLEFTAAVFAAMII
    TAKVVYK

    >gi|146303979|ref|YP_001191295.1| rhodanese domain-containing protein [Metallosphaera sedula DSM 5348]
    MSKYVNQEVLVDTKYVLDNVGNEKVRIVEVDYDHSTAYDAWHIPNAILVRWREDLRHPEIRDFITPQQFEDLMSRLGISN
    DSTVILYGDYNNWFATYAFWLFKAYGHQDVRLLNGGRTKWAKLGLPTSKDVPRYPKTEYKVSKVDWGSHRVLMWEVLQKV
    SRGETGKIATLIDVRSPKEYTGEIKAPPEYADEQTQVGGHIPGAINIPWAQAVNPDTGEFKAYEELLRIYSNVPKDKEII
    TY
    CRIGERAAHTWFVLKYLLGYPAVRVYDGSSAEWNNVVGIPVKKGTEP

    >gi|146304009|ref|YP_001191325.1| mercuric reductase [Metallosphaera sedula DSM 5348]
    MHKLAIIGYGAAGFAAMIKANELGVKPVLIGKGEIGGTCVNVGCVPSKRMLYIAEIYKKAREVTGSEVYPPFSSFQEKDG
    LVQEMRKTKYEDLLSYYDVELIQGEARFISPHAVKVNGQVIEAEKFVIATGSSPLIPRIPGLDKVGFWTNREALSPDRRI
    DSLAVIGGRALALEFAQMYSRMKVEVAILQRSPVLIPDWEPEASVEARRIMENDGVAVVTGVNVKEVRKGAGKIVITDKG
    EVEADEILLATGRKPNVDLGLENAGVRLNERGGIKVDDELRTDNPHIYAAGDVLGGKMLEALAGRQGSIATENALTGSHK
    RVDENAVPQVIFTQPNLARVGLTEAEARAKEGEVEARVLPMSSVAKAEIINSRLGFVKMVTMNGRIVGVHAVGENVAEMI
    GEAALAIRFGATVHDLIDTVHMFPTIAESLRLVALAFRSDVSRLSC
    CV

    >gi|146304077|ref|YP_001191393.1| OsmC family protein [Metallosphaera sedula DSM 5348]
    MRINNIDQDALQTLRERGSREGSIPMERHIEGEFRLEGSPMFVAEMKTETTKVIVTADEPKILGGQGVHGTPLSYVLFGV
    MA
    CFASTLALEASQAGIVMERLNVRGHIYYDLAPVVTDKEGPIIKKLVLEVISDKDLSKVLERAERKCPALFLVKNPIPV
    EVRQTGGTR

    >gi|146304080|ref|YP_001191396.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Metallosphaera sedula DSM 5348]
    MKLKVGDQAPDFEGVSERGDKVRLSDFRGKYVVLYFYPKDDTPGCRAEALSFKENWDEILKRGAVVLGVSGDSPESHVRF
    KEKYGLPFTLISDEGDKIRELYGAKGLLIPGRVTFVIDPEGKIRLIYSSQMNPTSHVKEALKVIPPVPTT

    >gi|146304240|ref|YP_001191556.1| DSBA oxidoreductase [Metallosphaera sedula DSM 5348]
    MQITFFHDVLCPFCYVTNKRLKKVLSEYKDVHVKHKAFMIISSLDDLLAAAPTPEDARELFKNEFSILTRYFPDYDPKKV
    IEKGKIGHIWSMPPLMACKAAEFQRGDEGHWEYFTLAQEKFFMEGENVNDDEVLLSIAEQIGLDMDRFKKDFKSKEAKLA
    VIQDEEEAKAMGIKGVPALLINEKWLIRGVQTEEYLKQVIDDVLHYGEPKKIELKAYWEQ

    >gi|146304242|ref|YP_001191558.1| OsmC family protein [Metallosphaera sedula DSM 5348]
    MITFTAEAKLEGETAVVSVKDLELKIGLIGSENPTPEELMLGAALSCMILTIYYISREMGVKLQGVEGYIEGNLDPKGFQ
    GDPNVPPGLLQVKYDLTVFSDDERIGKVMELSMRRCPLKDTLMRSVDVDVTWKIRKT

    >gi|146304289|ref|YP_001191605.1| putative peroxiredoxin [Metallosphaera sedula DSM 5348]
    MVKTYQKFPDVQVMTTAGPIDFYKDVFGKGKWLFLFAHPADFTPVCTTEFAEFARNYSEFEKLGVQLVGLSVDSIYSHIA
    WLTDIEQRYGLKIPFPVIADPEKKLARLLDLVEENSGLTVRGVFIVDPQGTIRFMAQYPIEAGRNIQELIRITKALIVSY
    KAKVSTPVNWEPGKEVVVGAPTTLMEAEMRMKLPNAKAWYLMFKKYDELPPDQRV

    >gi|146304313|ref|YP_001191629.1| DsrE family protein [Metallosphaera sedula DSM 5348]
    MAQTQTEQTQEEQKKKILIVVTHGPEDLDRTYAPLFMASISASMEYETSVFFMIKGPLLLSKKWQEDERKKGGNPFIHFF
    DMAKDNNVKMYV
    CVQSLKDMCHMNESDVVDGIELVGGSTLIDLTLDADRTLFF

    >gi|146304314|ref|YP_001191630.1| dihydrolipoamide dehydrogenase [Metallosphaera sedula DSM 5348]
    MKFDVVIIGGGSSGYVAGSVLARHGKNVLVVEKEKFGGVCVRSGCVPSIFLYDVSFSLSRSSEIGNYKGLTIDVGARDIF
    ASRNTLIEYLSDAGQKLVENAGGTTLIGEARVKGSVVEVNGKEIEYDNMIIASGSSPLLPRIKGVEGGITEDQAVNLDYV
    PKEMVVVGGGFAGVEIAQFFARLGSSVSLVTRGRILQEMSEEARKIILDSLEWDGVTVKENCEPVYQDGKLLKTTCGEFR
    GEVVYATGRRPNIPEDVSSVGVKVNCNGIVVDRYMRTSNPRIWAVGDVVDKERKVAHSAMMEGIVASLSILGQPVEVDYS
    VVPQVIYTDPQVAVVGNRRNVVKFSTFPLSASTRAIIHGIREGYVRLGFDEKDRICFGEVVSHYSEEIINIVSIAIKAGM
    RAKDLALVPFVHPSISESVSNTAKALFNLDVDVFKDKNGT

    >gi|146304316|ref|YP_001191632.1| hypothetical protein Msed_1553 [Metallosphaera sedula DSM 5348]
    MSYDSIVKQYLKVIKGLKINHCKASELISQLSGANIQVEENEGCEKPQIHVWSNGRKHFSYLGIPAVNELWPFLNALVRI
    STNTVQLDPQELDMAKMVRGNVKLFVTPD
    CTKCPIAAELLYQVALVNQNVELEIIDSETYDDLAKKYHVLSVPKIVLNDK
    TEIPGGFPPNIVLKMLVKSSSSQGTQP

    >gi|146304349|ref|YP_001191665.1| methylated-DNA--protein-cysteine methyltransferase [Metallosphaera sedula DSM 5348]
    MIRYGTYMSPFGPITLVSEDEKIVMLDFCKCAEESLVDNNSFVGLFKKLDNYFQGKRTDFDDIPIRLNTNSFRMRVYKEV
    RKVKWGEVVTYKDIAEAVGTSPRAVGVALSKNPILLLIP
    CHRVVAENGLGGYSRGVELKRKLLELEGSLIKVPSIK

    >gi|146304377|ref|YP_001191693.1| thioredoxin [Metallosphaera sedula DSM 5348]
    MSELEQLAKEISERLNKKALSLERRTEEKIVAITDDGLEEVLSKNKVVVIDFWAQWCAPCHLYEPVFKRVASKYSDKALF
    GRLNVDENPKTADKFGIMNIPTTLILVDGQVKETLVGAVDEDTLENALKKYI

    >gi|146304614|ref|YP_001191930.1| thioredoxin/glutaredoxin-like protein [Metallosphaera sedula DSM 5348]
    MEVEIFTHRNCTECNLLVEYLEEKGLLGKVKLVDTETQPFLALERGVISTPSIFVDGKLVYAGKVDLEEFEEILKGKGVA
    RTYNREELVTRLMEGIVDSFAATAWLYVNRDFDSFLSQRDFVMAVTGLALSENPEEGFNYLRNVLVKDRERILQEWEPRM
    FRNISSNFVREIYWLYGKKVPREELFSRYTLEIFAHWLMVRGGAVGRVGLRIHPLSEVDTMTRIAKVYGYVMENYDSLWD
    KVEKEQKSLKGIHAVGKP

    >gi|146304628|ref|YP_001191944.1| UBA/THIF-type NAD/FAD binding protein [Metallosphaera sedula DSM 5348]
    MFTRQLLVLGPEAQEKLSSLDVLVAGCGALGTAILELLVRLGVGRIAVVDADVIETSNLHRTHLFTLSDVGKPKALVCAQ
    RAMEIGSGSKVTPILDIVDETNAESLVKGRDFVFDALDNVNPRLILNDACVKNGVPLIYGGVTGEYGSAMFVSPRDTPCL
    SCFMEPVEQADA
    CETMGTTAMTVSLVANLQVQMMLNAIRGDIPRGLYYVDARSLTLQAVDMKRNPSCEACSLGEYRYLKG
    IRMNCGLVRVNERPPAGPRPYLKRTPDGLLICYENCFKKIGR

    >gi|146304719|ref|YP_001192035.1| dihydrolipoamide dehydrogenase [Metallosphaera sedula DSM 5348]
    MDFDVIVIGGGVAGVSAALRASELGKSVALVERDQVGGECINRACIPSKTLIDAVKTVNRVSSSPWIVSSATLDYAKLNE
    NKARIITAIKDRMEHNLNARNVKVIKGNAKIKAQGEVEVDGRTITGDHLVLSTGSVPLSLPDFPLNGRNVLDPWTAMNLK
    EIKNRIVIVGGGVAGVELATLFRALNKEVTILELMPQLLPGFDRDLASATKKRLEEKGIRIYLNAKSKIVNSEGTVKFSV
    NLPNASEEVEGDLAVVTIGRKASTENLNLKEIGVETDQRGYVKVDERGRTTNPKVFAAGDVAGVPLSATKAWRQGIVAGD
    NIGGKESKMPKYIPSSIFADMEIGTVGKTLDDLKKAGIEAREIMVEMRDIPRAWTLNETDGFLKLVVAGNKIEGAHMIGE
    GATEVINTMALAMELGITTTQLYSVTFSHPTVSEVIGEAIQRLTHGEIY

    >gi|146304757|ref|YP_001192073.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Metallosphaera sedula DSM 5348]
    MKLTVVGSGPAGLYSALTASEQGAKVTLVDRSEKLGGTCVLFGCIPSKAMMSPLFLSYASQKYGKSVEFSYSELEEFARS
    VVQRVSKGVEYMLESAGVEVVKGEAKLNSGKIEVSGQILESDSVIVATGTEKPQIPGTIASDDLHFLDREFNTVLLVGGG
    VGGVEYGWLLHLAKKKVTIVEREDLLLPGHDRDLRASVTSHFKRLGIDVRTNSVAEISDKVKINGGLEDFDLVVFTFGRK
    PAVKGFENLVGNKWIGVNEYMETKINHVYAAGDVTGTFTAHEAIHKGIIAGLNATGTRRSYRGEGVPKVLYTHPEIAYVG
    NTDGKCVKLSMAEVVRAVAERSTEGFIKVCVNEDGTLRGGVAFGERAEDIVSTLSLLIQLHVKVQDAKELMFPHPSYLEG
    LWEALRRLKP

    >gi|146304828|ref|YP_001192144.1| NADPH:sulfur oxidoreductase [Metallosphaera sedula DSM 5348]
    MPESLVVLGGGAAGMSAASRARRLRPDLRITVIESTKMVSHAPCGIPYFVEGLFDDENLFMTYTPSYFERERKIEVLTNT
    VAKEVDLDSRVVRTDNGKALEYDWLVVSLGALPKTLPNVKGNRVYYVHHPAHAVEIRERLWSMNKIAVIGGGILGVEMAE
    ALSAVGKKVVLIHRGPYILNKMLDQDLGDVVTKLVQGKVELHLNESTEEIGENYVKTDKGKYQVDGVVLALGVTPNVAMF
    KEKLQLGTTGAIKTNSRMETSVKGVYAAGDVAETTHVVSRREVWMPFAPVANKMGFVAGSNIGGKVTEFPGTVGNMITKF
    QDMFIGKVGLNEIEAKEVGFRPISATIKSKTRARYYPGAKDIYVKLVADEDSKRILGGQIVGGEEVLGRLDSVSVALMKQ
    LTVEEMFFAEMGYLPAISQVWDPLTVAARQLLKA