Aciduliprofundum boonei T469 uid43333

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|289595901|ref|YP_003482597.1| alkylhydroperoxidase like protein, AhpD family [Aciduliprofundum boonei T469]
    MDPEETLNEIGMYLEKLGKDYPQETGAFMSFLRRTIQEKALDTKTKELIALALGIAAGCEWCIVLHTKNALEAGAKPEEL
    VEAGYVAVLMAGGPALMHLIPLMKAIEEFKK

    >gi|289596132|ref|YP_003482828.1| methylated-DNA/protein-cysteine methyltransferase [Aciduliprofundum boonei T469]
    MDLYSYFYDLVMQIPKGRVSTYGALARALGDIRAARACGVMLSQNPDPPRIPCHRVVMSDGSLGGFTHPEGIKRKIELLR
    SEGIKIENGKVKDFSKVLFEDFKTDYPLKKLRKEQEELRKKVILEDAHPSLIGGVDVSYSSRNAYVALVIMRDGKYEVIG
    EKMRVDFPYIPTYLAFREEPIILEILKKVDDDILLMIDGNGILHPRFMGLATYVGVKNNVATIGVAKSLLMGEVREGKVY
    IGSQLVGQYIQSGRKKGIYVSPGHRITLDSAVRVVKKYLKYKNPEPLRLAHIYANKFRREDNA

    >gi|289596173|ref|YP_003482869.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Aciduliprofundum boonei T469]
    MKEYDIIAFGTGSSMNIVSPLLRDPNLKVAVIENEKAGGICLTRGCIPSKMLIYPAEIMHIIHRAREFYIDAKAKPDADA
    ILHYVQKSVDDESKMIERSLKSHPRIDYYQKTGKFVDDYTVDVGGKEIYGETILLCNGSKAYVPKIEGLKEVGYITNREF
    FYSLKHVPKSIAIIGGGYVALELGYFLAMMGSEVHIIEMLPEIIMTEEPEARKLVYKELSKFMHFHLGYKAKEARKSMGK
    KVVFAENKDGETVEIKAEEVLVAAGRAPWNKETQVEKTGVKVDEHGWIVVDEFMRTTKEGIWACGDTNGKYMFKHVANYE
    SEIVFYNAFGGRKLKVDYHAVPHAIFTYPQVAHVGMKEEDARRKYEILIGDYKYQDTAMGEAMKLKDYFVKVIVDKDTYR
    ILGATIVGPEASVLIQEIINLMYTREQTSAMYRALHIHPAMNEVVQRAFYNLHEP

    >gi|289596552|ref|YP_003483248.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Aciduliprofundum boonei T469]
    MKEGDIAEDFCLPDYEGKEHCLCDYRGKWVVLYFYPKDNTSGCTKEAKGFTEMQDEFEKLGAVIIGVSKDSPKSHAKFIE
    KHNLKILLLSDEEHKVLERYGAWGKKKNYGREYYGTIRTTFLIDPEGKIVKVWRNVRVNGHVEKVLEELKKFVEVKK

    >gi|289596557|ref|YP_003483253.1| OsmC family protein [Aciduliprofundum boonei T469]
    MDEKKSDNALENIDFEALGDLLAAESVWIGDGRTKTKIHDMELEVDNPLSVSPINPPPHVTWPEQLLPAALAVCFITTMT
    AINDKIGVHINELRVIVKPILGIDTDGGFKFDKMKLNVKLSIARGEKSKAEKLVEITHKY
    CLVSKAIKGNVKEIIEVDIK
    EVD

    >gi|289596558|ref|YP_003483254.1| Peroxiredoxin [Aciduliprofundum boonei T469]
    MVVIGEKFPEVEVNTTHGKMKLPDHFAGKWFVLFSHPADFTPVCTTEFYAMQKRLDKFKELGVEVIGLSVDQVFAHLKWI
    EWIKDNLGEEIQFPVIADDRGDLADMLGMIPTGSTQTARAVFIVDPKGTIRAIVYYPAELGRDWDEILRAVKALQISDAN
    GVAMPHKWPNNELIKDRVIVPPAGSVDAIKDREEAKKKGEIECYDWWLCHKSL

    >gi|289596632|ref|YP_003483328.1| Methyltransferase type 11 [Aciduliprofundum boonei T469]
    MGNPKVSVVITGFEAKFYDELLDFITLFQYGKFIKKLMYEETEVGYGDNVAELGVGNGRNAILLSNRVGEKGEIVGFDIS
    PDMLEKAKKKTKDYKNIRIIKHDIRLDFPKEFYDYFDVALIALAFHGFTPRDRERILDNVRKILKDGGKFYILDYNQMNY
    AKSPFYFKILIDKFE
    CPLAEEFLGYDLINVANKYGFRLTKKRTYVKGLFQYSEFTLEK

    >gi|289596634|ref|YP_003483330.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Aciduliprofundum boonei T469]
    MIVIIGLGTGGIYAARWISRFNRKEKITIIERRSYETYSPCSIPLVVEGAIDLKEIIHPFPRTPRIDVLLEHEAVEIDTK
    GKRVLYRKIGSDEMKEIEYDKLIYAAGARPSVPPIKGVEKKGVFTVRTVEDAKNINEWAKKAKKALIIGAGAIGMEMAYA
    LRKRGLDVTIVEMLEHPFPKALDEDMAKIVKERLESMGIKCHCNSKVEEILGKEKVKGALVNGEEIDADMVILSVGVRPN
    TELLKGKVDMDDRGYIIVNERMQTSLPDIFAVGDCARTPYGILQLATIAAREGIVAGINAAGGDAIYTKHTGAFVSTMGN
    FEVACVGERSEISGRGHSTITPYSKHEIFVKIFTDKEGKIKGAQAVGYMASKKIDIISALMRGGGRIWDVAFMEHAYCPA
    SAHLYDVINIAANNAMRKIKIEKYTV

    >gi|289596652|ref|YP_003483348.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Aciduliprofundum boonei T469]
    MAMKRIGVFICHCGRNIAGTVDVKRVAEEIGKREDVAFSTTYVFMCSQPGQKLIEDSIKKYNLDGVVVANCSPTLHERTM
    RNAAARAGLNPYRVEIANIREWAAWPHEDNPEAATRKAIRIINATIEKLKANASLHPLEVPVKKRALVIGGGVAGMQAAL
    DLADAGIETVVVEREPSLGGNMIRLSETFPTLDCPQ
    CILTPKMNDVGGHPNIKLYTYSEVEEIEGYLGNFKVKIKRKSPF
    IDWDKCTGCGECAKVCPTVLPSDFDLKMATRKATHIPFDQAVPFKYTITYNGVPPCNAACPLHLDAQGYVAAAKAGRFDR
    SIDVVWEKLPFAGIAGRICTHPCESACSRGDIDKPVGIREIKRFVADWAVKNKRKYILHVKEEKDKSVAVIGAGAAGLMA
    AHDLREMGYKVTVYDKLPVVGGMLAVGIPPYRLPQEVIDYEVQPLIDAGVEFVLNYEVNEKNFEEIRKKHDAVIIAIGTH
    KERHLGIPGEEKAMHALELLRKVNLGEEVDLKGKKVVVIGGGNSAVDASRTALRLGADVTIAYRRTRTEMPAIPEEIVDA
    EEEGVKFKFLVSPAEILDGKIKLEKMKLGEKDASGRRKPIPTGEYELMDADVVVLAVGELPDASWAEKLGIEVDRNRIKT
    NKFMQTSIENVFAAGDAVTGAWDWVHAAAYGRWAAKNVAHYLEGEDMEEVKIEMSSSLKGYRELAYPAPRHETKKLDMEE
    RKSTFKEFNLGYADEDVVDEAKRCLGCGGCAKCGLCVEVCEAKAIDLHMQDWYVEEEVGAIIVATGYEVMPAEAFPELGG
    KYPDVITSLQFERLLAPSGPTEGIPRRPSDGKIPKSIALVHCVGSRDPQNGVPYCSRICCMYTIKQGMLVKHAMPDVAVY
    DFYIDIRSNGKGYEEFYHRAKEEYGVNFIRGKVSKVYKVGDKYRVQGVDTLTGRIIEVDVDMVILATAAKGSSGVKELAK
    KLRIPYDEWGWLKETHLKLKPLETPVGGVFIAGAAQFIKDITDSVSQGSGAAAKAMALLSKPELEKEPLLARVDTEICAG
    CGRCKDQCAYGAITIDPVRHVAMVNEALCEGCGACSANCPTTAIQVVNFKKGQVIRAVDVLAEVF

    >gi|289596951|ref|YP_003483647.1| glutaredoxin-like domain protein [Aciduliprofundum boonei T469]
    MGYIQDKDKKYLKGEFDKNLKEDVYILVFVGDNCQYCGVASAIAQEVAELHPKIHFEEHRIGDDLSEEYGLKNAPTVVIT
    DKEKYGGRIRYVGLPSGYEFSSMIEDIIDVSRRTAEVSQEVLEKLMKIDKPIIIQIFVTPT
    CPYCPRAVRTSHRFAILNE
    NITGEMVEAMEFPEWADKWKVMSVPHIVINEDVQFIGAYPDEQYIEYVIQAYEKMR

    >gi|289596952|ref|YP_003483648.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Aciduliprofundum boonei T469]
    MDFGFVLPTGSRESKDVDLAIIGGGPAGLSAGIYAKRAGLEAIIIDKGNAGGLAEEAPYVENYLGYKGIKGEELVKEFKE
    HAMDYVEISERNEVKEITKEGDIFIINAEKGEYKAKAIIFATGTTHKTLGVPGEKELFGKGVSY
    CVTCDGYFYRGKKVAV
    IGGGNSGAIAAIYLKDIGVEPVVLEYMPKFMCEKAYENIIKDRKIPYYTNVQVTSIEGKDKVEKVVYKDRATGEINEIQV
    DGVFIYVGLIPISDLAKKLGVKTDERGYINVDLKMRTNVPRIYAAGDVTGYAGQIIIAAGQGAMAALSAYEDLMLH

    >gi|289597203|ref|YP_003483899.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Aciduliprofundum boonei T469]
    MIYDTVVIGGGPAGLAASIKAKELGLKVLLLDEKEYLGGILPQCIHPGFGLHYFKEDLTGPEFAHKLIEKFRSLNVEYIT
    EATVLDISVEEELKRVKYVSPQGLEEVLTKSIIYASGARERHRFEIGIVGDRVAGVFTAGEAQTMMDIYGIMPGKEIVIV
    GSGDVGLIMARRFALEGAEVKAVIELMPYPGGLARNIIQCLQDFSIPLYLSHKVIEIRGKNRVESVKVVKVNDKLEPVEG
    TEFDIECDTVIISAGLVPRVKLLEKIGIDIDARTGGPVVDENLETSVRGIFVAGNSLIINDLVDYVVEQGELAAFSAKNY
    VDNNLPSSRKIKIKIEGNLRFVVPHYISGEKNVIFYARVKNPQENVTLKFGDIGYKIKYPVVKPSEMLKIRLPVKKIQKE
    IKELTLEVE

    >gi|289596274|ref|YP_003482970.1| OsmC family protein [Aciduliprofundum boonei T469]
    MRHIEGMRFVGETDEHSIILESAYLGEQKGPAPMEALLMSLGGCTGMDVVAILRKMRDEPKKFEIEIEGETAQEHPKVYT
    KVHLKYIFWGVEYEKAKKAVELSQNRYCPVSATLKRGGTEVTYEIIIKD