Ignisphaera aggregans DSM 17230 uid51875

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|305662726|ref|YP_003859014.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ignisphaera aggregans DSM 17230]
    MNIVVIGGGAAGSAAAARAKRLMPNANVILIEATDMITHGPCGIPYFISGIVSSRDSLVTYTPEVFERERGIKVLINSEV
    IDIDIDKHFVEVVKKNNYTKEKIIWDKLIIATGAIPIIPRIPGIDLKGIYAIRHPAYVHHLRDELSNLRTISIVGGSYLG
    IEMAEALLELGKRVILFEKESSLLPASLDEDMAKIVADELIKKGVEVHLGEQVIGFDGRERVESIVTNVNSYRVDGVILA
    MGVKPNVSLAQKAGIKIGSTGAIEVNEFMETNIDDIYAAGDVAEKIHRITKRRTWIPLAPTANKEGVVAGANAARGRILR
    FPGVIGTAITKFYDLYIARTGISEKEAKTLNIKYEAKMIRAKTKAHYYPSSKDVYIKMIIESSSSKIIGVQIVGWDPIVA
    GYIDIVAIAIERGVTIEDLFFSDLSYMPATAPVWHPLIVAARVLSKGIL

    >gi|305662821|ref|YP_003859109.1| methylated-DNA/protein-cysteinemethyltransferase [Ignisphaera aggregans DSM 17230]
    MNGIRYVLRIKNGEIYASKMDYETLKEIVYALVSLIPIGHVATYGEIADILKISPRIVGKILSENIHPIAIPCHRVIRSD
    GKIGGYTIGGKKNSYFKYKLLKLETFGRPPSRYNLRKILEL

    >gi|305663614|ref|YP_003859902.1| glutaredoxin-like domain protein [Ignisphaera aggregans DSM 17230]
    MSQYSLPPYIEEMFKLELSDRDITVLKETLSELRKPVAIKLFTTNDRMSCFSCRETEKLLTLLQTVSPSIGDKPAINLDI
    IDIVKSSEIAKKYNVLKAPTIILLDGAITYLGMPAGEELKGFIETIIRISTDDHGLSENTLKELANLEGKADIEVIVTPP
    CPYCPYAALLANMFAYASSMIGKGNVRSYIVEAYEFPEIADKYAVTTVPTIAINSRVVFVGLPYEGQMLKAIKRLASLYV


    >gi|305663729|ref|YP_003860017.1| thioredoxin reductase (NADPH) [Ignisphaera aggregans DSM 17230]
    MSRFRLDIHKPIKDRFEAIVIGAGPAGLTAALYLARYGVDVCIVSKDLGGNMAIAPLVDDYPGIRNIKGSELTKLFAEHV
    KSYNVPLYIGTKVISIAREDNMFRITTEDNRNLYSYAIVIAIGLRNKRLGVPGEEKFIGRGVSY
    CAVCDGPMFSGRDVAV
    VGGGNSALLSAIYLSSIAKKVYLIHRRDTFRAFDIYVKQVKSSRNIELLLNHIVTEIIGDDKVRAIRVKNTVSSEEREID
    VDGIFIEIGFETDREFLESIGLKLDEDGRIVVGPDGRTNIPGIYACGSVTGGPYRYKFDQIITAAAEGAIVADAVYKYLI
    GLKSRGGL

    >gi|305663847|ref|YP_003860135.1| Thioredoxin domain [Ignisphaera aggregans DSM 17230]
    MSPIKEDPINEIDELDSILNTMAQNIIRTSYSRDKTFSNIQTKCCNTVIEGGISIRSYSEFIQLINSCRVAFVLITTTYC
    PY
    CQLFKPVFFRVAREFAGKAVFIEANADYVPEVAETFNVYSTPTTVIIIDKRPIDAILGYIPYNHFKRYVNDIVSYAEC
    GEI

    >gi|305663947|ref|YP_003860235.1| 1-Cys peroxiredoxin [Ignisphaera aggregans DSM 17230]
    MVGQIPLIGEKFPEMTVVTTHGVKKLPDDYKGKWLVLFSHPADFTPVCTTEFYAFAKRYNDFKELNTELLGHSVDSVYSH
    IKWIEWIKEKLGIEIPFPIIADPTGDVARKLGFLHAQSASHTVRAVFIVDPDGIIRAILYYPQEVGRNIDEILRLLKALQ
    VNTQYKVALPANWPNNELIGQNAIVPPASNVIDAAERLKQYKCYDWWFCYKEIPEQEAERARAFLKRVAGL

    >gi|305664128|ref|YP_003860416.1| Thioredoxin-disulfide reductase [Ignisphaera aggregans DSM 17230]
    MDVESYDVVIIGGGIAGFSAALYTARQGLKTAVITIDIGGQLSYASVIENYPGVEAISGLNLVLKVQNQALSYGVEVYID
    EVIGLEKTDQGFLVRTKKGLVFNAISVIAACGKAPKRLGIESEDNFIGRGLSY
    CVICDGPLYRGKDVALVSFGEKGIENI
    QFLASIARKVYYIVSSERDPSIEIAKEYSNVSIFTGHRVVELYGGQKLEKIVLVDKNGNRVEINIDALFVELGFETRIDF
    LKPFVDVNDKGEVIVDKYGRTKTEGLFAAGDLVETPYKQAVIAASSGVIAALSAINYVYSVKGLRRSIVSDWMKKQKTER
    VISKFRL

    >gi|305664190|ref|YP_003860478.1| All-trans-retinol 13,14-reductase [Ignisphaera aggregans DSM 17230]
    MVRKIPGMLYIFISFIPWIIYWVLCGIGFGLGIAISFLISLILIVSQIYRRYFNFMDIVSIIYFCIAFIGTFIFGLNIFV
    EESGFLGYFALFLMALFSLIIKQPYTLQVSKRDYPEVYWRDRMFIKINNIITIVWTMIFITNALIFLLLKAPLNIISSNI
    LIAFGMVFSIVFPLKAPAYFISRNFKRYDWSVGVDPKRPKGEDEYDVIIVGSGIGGLTCGALLSKRGYKVLVLEQHYQVG
    GY
    CSSFMRRGFIFNTGVEDVSGLWERGPVSYLLNELGLSRDELFVRNRVRFIFRGREIDVDNLEGFIRILSEMFPEERDD
    IYAFFDEAMKAYDECYKDLIYGVPLPAELIAKVFGSKKLLDYPKEHPHFYDWMNKTYKEKLDEFFSNDDLKTLLCALLGY
    LGTKPEETPASSALTAVVSYYLYGGYFPKGGAQRFADTLKNYIESHGGKVLIRHRVDKIIIENREVRGVKVGNKIFRSRI
    VVANTNAKTALLELVGEKHLPKDYAEYIKNLKMSPSAFMVFLGIDMDLSSYPTIINNLDEGYSIVINSNADPSLAPRGKA
    SITILTIANYHEFPERGTREYLEKKRELAEMLIRKVEKIIPDISRHIVVIDIATPRTFERYTSMPEGAIYAFDQSIHTKR
    PYFKTPIKGLYLASASTFPGGGIEAVVISGIICANDICGWRLSKN