Ignicoccus hospitalis KIN4 I uid58365

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|156936998|ref|YP_001434794.1| methylated-DNA--protein-cysteine methyltransferase [Ignicoccus hospitalis KIN4/I]
    MLRRLELLKELLLLIPLGKVTTYSSLASLLGTHPRAVGAMLARNEDLVVYPCHRVVMSDGRLGGYALGKEFKRRLLELEG
    VKFCGPERVCKESVVDLKELLS

    >gi|156937133|ref|YP_001434929.1| hypothetical protein Igni_0339 [Ignicoccus hospitalis KIN4/I]
    MVAGRYTEILLTCRNPYPGKAVDFLVAFFYSDYCPTCDDVRPHWEEFVELHRGEGTFIRIKKSPETAKLFKSLGVSWVPT
    VVFYHDDKEVKRIEGFFTLSDLERAMRRFLSRVSARTSPRACSPQKA

    >gi|156937253|ref|YP_001435049.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ignicoccus hospitalis KIN4/I]
    MPGQIPLIGEKLPEMVVHTDHGPKKLPDDYKGKWLVIFSHPADFTPVCTTEFVAFAKRYEDFKKLNTELLGLSVDNSFSH
    IKWKEWIKEKLNVEIPFPIIADPLGQVATKLGMLHPEGGVVTVRAVFIVDPEGKVRAILYYPLNVGRNIDEILRLLKALQ
    VTDKLGRATPANWPCNEIVKDHVIVPPASTEQEAKERLQKYECFDWWFCHEKAPAEDVEEAKKFLERPAKELCK

    >gi|156937464|ref|YP_001435260.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ignicoccus hospitalis KIN4/I]
    MGPVPHVEVVVVGGGAAGMSAASRVKRIHKDWTVRVFEASGYVSYAPCGLPYFIVGKVKEPDDLVYYPVEVFREKRGIDV
    HTHAKVVDADYHKRTVTVIENGEKKEYKWDKLILATGARPKSLGVEGEDLRGVIKLHTVESGIAAREELKDAKEVVVVGA
    GFTGVEVAAELRDSEREVHLVVRSRALRKSLDPEMSELVEEHLKNVGIRLHKGVTVTKILGKDRVEGVELSDGEVIKAQA
    VVVAVGVEPNAELAKRLGVKLGKFGGIKVNEYMETNLPDVYAAGDVAESWLVHTGTEAWCPFAPPANKMGLVAGLSASGK
    RVPFPGVACTGITVASGLEIGRTGLTEEEAKALGFKVKSSFVKARTRAHYYPGSQFTHVKLVAAEDGTVLGVQVVGPEGV
    KGRVDAVATLLTKRGTVRDLFFSDIGYVPPLAPVWDPLVTAARLLYSELR

    >gi|156937697|ref|YP_001435493.1| glutaredoxin-like domain-containing protein [Ignicoccus hospitalis KIN4/I]
    MSFGMEWTPEARAGLREALADMKGPVEALVFVEEGCEPCEATIEMMQVMKEESPKVNGKPYFDYKVFWRGKDDEAFDKYK
    VDRVPSVLLLDGYIRYTGIPAGEEVKGFVETVIRISENESGLDEETKEGLKKLKGCYYIENVVTPQ
    CPYCPYAALLINMF
    AFEAKKQGNPCVVADTVEAYENEDIADKYNVMSVPAIAINGNVEFVGVPYEDDLLAKLFEVEPKGPCEDEVCFVRP

    >gi|156937702|ref|YP_001435498.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ignicoccus hospitalis KIN4/I]
    MLRLGAPAKRPKGGEFDVVVIGAGPGGLTAAMYAARLGLKTVVLEKDNKPGGRTSLAPVVEDYPGIDKIGGEELAQRFLN
    QATKFGAQVVFGERVVDADFSKEEMKVVRTHKGREYKAPAVIIATGVSTKGLGVKGEKEYFGKGVSY
    CVVCDAPFFKGEP
    MALVGYDDHAMEEAVYMTSLASKVYIVTHGKKIEASESYMSVLRNNPKVEILEGAKVKEIVGDGQKVTGLVVELPDGTTK
    TLPVRAVFISYGEVPSTEIFKKAGVEVDERGFIKIDPYTRTNVPGVFAVGDVTGIGFQIVIAAGHGATAALEASKYVKRI
    KRKVAVKQ