Hyperthermus butylicus DSM 5456 uid57755

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|124027068|ref|YP_001012388.1| iron III ABC transporter, periplasmic substrate-binding protein [Hyperthermus butylicus DSM 5456]
    MAYRSVALIILLVVAALVAGIAIGYTVGGKNGMAPAQEQPVTQPAGQEPQAGMQGEPQVVEEALRSRVVVLVDALGREVT
    LARPPERIASLAPSITEVVCALGACDRLVAVDNISMSIVERELGAEAVKLVSVGSFWQPSSELVLSANPDMVLA
    CSGVPA
    QEAMVGQLEDADIKVFFLRCDRSRNIGDIYWDISTLGVMLNETAKASEIIEEIQARLQSVATAVANETSPTVALVVYMDS
    NGVYVAGGGNFQDNLIQLAGGVNVFGDYYGWPMISYEDIVVRDPDYIVVTSMGTANDTISLIKSTLLSKTKAYSEGHVCI
    VTGEAVDVLSRPSVRIADAVELLASILHPDAVEPPSKLAGYITCIGAGG

    >gi|124027077|ref|YP_001012397.1| thioredoxin reductase [Hyperthermus butylicus DSM 5456]
    MAEQTGQTVGRSVEGEVERHDVIIVGAGMAGLTAALYLARQGVDVLVVSRDLGGQLMQATIIENYPGIEAVKGPELAMRV
    EKQARTFGAKFRYGEQIVRIDKLEDGTFLLESNRGRRYQAEVVILAFGKTPKRMNIPGEDEYDGRGVSY
    CTICDGPLFRG
    RNTAVVGIGDQGLEAVALLAGLCPKVYYVTPTKLFGEPDLIARIKSAPNVEILEEHEPVKVLGDGKRVTGLVVRNKKTGE
    EKTLDVEGIFVELGYEARTEFVKHLVDLNENGEIITGKLGETRTPGLFAAGDVTDVPFKQAIISAGDAAKAALAAFNYLQ
    KRRGRNVTIRVTGRRLVGLSQKRR

    >gi|124027125|ref|YP_001012445.1| peroxiredoxin family protein [Hyperthermus butylicus DSM 5456]
    MPLQAPSIGEKFPEIEVMTTHGKIKLPDHFRGKWFVLFSHPADFTPVCTTEFVAFAKRYEDFKKLNTELIGLSVDSTFSH
    IKWAEWIKEKLGVEIPFPIIADPTGEVAKKLGLLHAQSSTATVRAVFVVDDKGVVRAILYYPQEVGRNIDEILRLIESLQ
    ISDKYGRAIPANWPNNELIGDNLIVPPAATVQEAEERLKKFKCFDWWFCYEDKATAEEKELARKFLKRVANC

    >gi|124027580|ref|YP_001012900.1| thioredoxin [Hyperthermus butylicus DSM 5456]
    MAEEDRELEEILENLARRIAQQRVSQSAEAVEAREPVTYITSYGLFREIICRNPLVVAIFTSPTCPACSVYKPIFYRYAA
    ETSKKLGRRIVFAEVDVYYAPEAAYEAGVMATPTTVIFKKCRPVDGFTGIADEETLHQIVLQHIAKG

    >gi|124027649|ref|YP_001012969.1| hypothetical protein Hbut_0771 [Hyperthermus butylicus DSM 5456]
    MTPDAWDEFDSLWDEYVAKAVEAAKRAGVVLARSYDEYRKAICSKPVAVVVFTSPTCPACAAYRPIFYEYARRMSQYRGK
    VAFVEVDSYSAYEAAMEAGVMATPTTVVYLKCKPVDGFIGLADEETLDEIVRPYITKAVEEGEEDE

    >gi|124027680|ref|YP_001013000.1| NADH oxidase [Hyperthermus butylicus DSM 5456]
    MLRVAVIGGGAAGMATASRVKRLLRDRAEVVVFEKTPWVSFALCGTPYYLSCKVKTLNDLLHYPLEEFTEKRGINVMLRT
    EVTDVELDARRLRYRRLDTGETGVYEFDYVVFATGARPRAPKNWLRFRNVFTLHSLADADRLREAVVRDSVRRVIVIGAG
    YTGIEAADNIALLGRRVVIVHSSKRILSRSLDPDIAEKVEERAKTAGIEFVLGRSVVDVEGSEGYARSVVLDNGEKMYGD
    LFVVSMGIEPNVELARRAGVRIGGTGAIWVDTRLRTSREEAYAVGDVAETVDILTGERIWWPFATAANKMGFVAGTNIAG
    GDAFFPGVVRTRAMGAFGLYIAGTGLLEEEARRMGFDVVTATLTAHTRARYMGHGPEIVLKVLADANTGMLLGAQALSED
    PSAFWRIAVVATLLMKKASVWDLFNADIGYWPGVNTVWDPLVVAARLLLRRLGTRPREVSRQDTGSKGA

    >gi|124027799|ref|YP_001013119.1| hypothetical protein Hbut_0926 [Hyperthermus butylicus DSM 5456]
    MGSKRWVAVFDPVKMEIDKETRDAIKEAFEDLVKPVEINVFIGPNCRYCDETVKIAKVLEEEAPVKNGKKLVTMKIYEKD
    KHVDVFKKHGVERIPSLTLVEGRIKYTGTPSGEELRGLVETIIRISQEDSGLDETTVEKIKLIEKPVHVEIIVTPQ
    CPYC
    PYAALLSNMFAYEAWRNGKTDFVSEIVEAYENPDIADKYGVTSVPAIAINGVLAFVGVPYEEDFIERIIDVVERRRTIKT
    EFLEGATGI

    >gi|124027929|ref|YP_001013249.1| dihydrolipoyl dehydrogenase [Hyperthermus butylicus DSM 5456]
    MPRFDLLVIGGGFGGYPAAVVAAQRGLKTAVVEARLLGGECANYACIPVKAMLSKASEIAAVLSRGFSVDKRFREALEYA
    LKVSQRVRSGIETVLEGYGVAVIRGRAKIRAPGVVHVEGYGDVEYEKLVIATGTDPGYPPGLEPDGKLVHDNRTILSYDG
    EPSKVVVVGGGPAGVEYADLFARLGAEVHLVEVLDRILPFMDVDLSRAVARYLRSIGVKLHTKTTIGRLEKLANGVEVVL
    SSGDRIKADIVVVATGRRPATSGLGLDVLGVKLDEKGYIIVDEYLRAAKDVYASGDVAGPPLLAHKAYSQAVTVGLNVSG
    EERKWSPKAIPLVVYTGLEAVQVGYTLDEARRRGYNAQEARIRLGAISMAVIKGAEYGVAKIVYDASSGRVLGLHLAAHG
    ASEVAGEAALAVERGVTVEELADLIHPHPSISEAIALAAEVAVGRPVNYLAKNKP

    >gi|124027983|ref|YP_001013303.1| 6-O-methylguanine DNA methyltransferase [Hyperthermus butylicus DSM 5456]
    MSWKDPRSLRDIVYVLLSAVPLGYTVTYSVLARLAGTSPRAIGVFMRQNRDLIVVPCHRVVSVRGLGGYSRGLSFKEKLL
    RLEGALSSDGGVLRRITSVEDYWRVLEEQGYTCCSIDV

    >gi|124027987|ref|YP_001013307.1| thioredoxin [Hyperthermus butylicus DSM 5456]
    MSNDIVRELRSLIEKKVNELDKELGDPLIYLNKDNFDEVLKNYKVVVVEFSAPWCNPCKAYTPVFKRVARRLADPEKGIV
    FAYLDTDEAPDIADRYSVDNIPTTIIFVNGHVADVILGVTQESKLTERVQNIVKELLRGEK

    >gi|124028235|ref|YP_001013555.1| hypothetical protein Hbut_1385 [Hyperthermus butylicus DSM 5456]
    MHLTIYIHPSCPASRNLVLYLHEKGLLNRVELVSTARPSTSGLLREAVWSVPWLVGEGVPLATDPIEPGEAELIIREFRT
    TRTSNPLDDFAEAILHSAYASAVAYLHGSLEPVLDCDFVMAATRAKLRGLDVSQVLLEAGHRAADLYADLEDKIMRALGI
    SYVRELYWASGGSLSREELVELATPIHVGAWLIAKASLGRSGLPSKPVPDKARLERLASFVRRGAAGLLRRIEREYQEVM
    EDENYWRILEEHGLA