Haloterrigena turkmenica DSM 5511 uid43501

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284163436|ref|YP_003401715.1| Heavy metal transport/detoxification protein [Haloterrigena turkmenica DSM 5511]
    MSQTITVEGMSCEHCEQTVEDALEGVEGVQSVNVDREAARATVEGDTDPQALVEAVDEAGYEAST

    >gi|284163438|ref|YP_003401717.1| heavy metal translocating P-type ATPase [Haloterrigena turkmenica DSM 5511]
    MSTRTVHLDIRGMSCANCSQTISDALESLDGVSEASINFATDEGTVEYDPAAVSLAELYAAIDEAGYEADRASRSIGITD
    MS
    CANCAETNESALESVPGVIEAEVNYATDEASVAYNPADASLGDLYAAIEDAGYTPVRDDADGSDESDRDRRDAARQAE
    IRKQRRLTIFGAVLSAPFLFFLADKFLLGGAYVPETVFGVSFGWVEFLLATPVYVLLGREFLENSYTALARNRTANMDVL
    IALGSSTAYLYSLVVLLGLLAGNLYFDTAAMILVFITLGNYLEARSKGQAGEALRKLLEMEAETATLVDADGNETEVPLE
    DVSVGDRMKVRPGEKVPTDGVVVDGQSAVDESMVTGESVPVEKGSGDEVIGSTINENGVLVVEATKVGEDTALQGIVQTV
    KEAQSRQPEIQNLADRISAYFVPAVILNALFWGLVWFLFPEALAGLVGWVPVLGLVGGGPAALSTFEFAVVVFASAVLIA
    CPCALGLATPAATMVGSTLGAQNGVLFKGGDVLERAKDVDTVVFDKTGTLTTGEMTLTDVVALEDEGEGKGARAAADGGD
    AAADGGAVATQSRLDESEVLRLAASAERDSEHPLAQAIVEGAEERGLELVDAEAFENVPGQGVRATVDGREVLVGNRRLL
    ESEGVDPSPAEGEMERLEGEGKTAMLVAVDGAVAGVVADADTVKESSADAVADLRERGLDVMLITGDNERTARAVAERVG
    IDPDNVRAGVLPEDKADALEDIQSTGRKAMMVGDGVNDAPALAVAHVGTAIGSGTDVAIEAADVTLMRDDPLDVVKAIRI
    SEATLAKIKQNLVWALGYNTAMIPLASLGLLQPVLAAGAMALSSVSVLSNSLLFRRYTPDRDYELLGRLRR

    >gi|284163547|ref|YP_003401826.1| Rhodanese domain protein [Haloterrigena turkmenica DSM 5511]
    MATDYANDVLVSADWAEERLDEFQDDDSDLRLVEVDVDTEAYEEEHAPGAIGFNWETQLQDQTQRDILEKEDFEELLGSH
    GISEDDTVVLYGDNSNWFAAYAYWQFKYYGHDDVKLLDGGREYWLENDYPTTDEEPDFSETEYDAAGPRESIRAYREDVE
    NAIERGVPLVDVRSPEEYSGEVLAPPGLQETAQRGGHIPGAKNISWAAVTNDDGTFKDYDELEELYAEEDIDGDETTVAY
    CRIGERSSVAWFALHELLGYEDTVNYDGSWTEWGNLVNAPIEKGN

    >gi|284163548|ref|YP_003401827.1| Rhodanese domain protein [Haloterrigena turkmenica DSM 5511]
    MNDSVVVTPDWLAAHREDPQVRIVDVRDAWEYDGIGHVPGAVSIPFDSYRDESDVDRGTLPGAEAFADLCSEAGISPEDT
    IVAYDDTHGVFAARFVLTALEYGHDDVRLLDGDYSAWNREYETSSETPDVESTEYEPDPLAPEESPLVDYAAVEAALERG
    ALFVDTREAHEFEEARLPGAVRFDWREVVDDETRRLKPADELEELLAEYGITPDREIVLY
    CNTARRISHTYVVLRALGYE
    NVSFYEGSLTEWLANDGEVESGEVE

    >gi|284163551|ref|YP_003401830.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Haloterrigena turkmenica DSM 5511]
    MDEYDLIAVGGGSGSQVATAAAERGLETAVIERGPLGGACITRGCVPSKALIHRADIADSVRHAEAFGVGAALEGVDYGE
    MTAAIHDTVYEKADRQEASLEDAENVTLYRGEGRFADERTLEVDLNDGGDVEVRGDSVVLGVGGRPMIPPIDGLEDVDFL
    TSDDALFLDEQPDSLVVVGGGYIGAELGYFFAALGTDVSLVGRSERLVPREDDAVSEVVTESLERYCDVYTGYEAAKVAE
    NDTGVVVTAEPNEGGDGDDGESSTGDGVELEADDLLLATGRRPNTDTLNLEATGVETDDGEYVVVDDRLETTCDGVWALG
    DIVGEQPFKHAADYEAKTVSANLLEDGDQAVDYGAMPHAIFTEPQVASVGRTEGELEDADREYESATVPFDAAPLGMIMD
    ADDGFVKVLAAPDGEILGCHIVGPQASTLIQEVVTAMEGGGTVDDVAEPVHVHPALSEVVYTAFDELSSSEFSTAPDWRD
    VSDE

    >gi|284163760|ref|YP_003402039.1| heavy metal translocating P-type ATPase [Haloterrigena turkmenica DSM 5511]
    MCPDSRNPDSSERPHTPAPSSPAEGSDGCDLCDLPLPSVPITDPDVDGTYCCRGCLEVARTLERRDDGPDEAAVRSRLDG
    ADAAGGRDLDDLDGEDAFLAVDGMH
    CSTCEAFLESVAEREAGVLGATASYATDTIRIVYDPDRLAADDLPEIVSGYGYTA
    ADRSGADGDAGSDDGLARLLLGGFFGMMVMVWYVLFLYPTYFDLEPVVAFGGYELAFLSANIWAFTSFILFYTGYPILRG
    AYVSLRAGRPNMDLLVATAALGSYGYSAVAIVLGESHLYFDVTVAVVLVVTAGTHYERAVKRRATGLLSELTERQVDEAR
    LESGETVPLEAVEPGDRLLVRPGERVPLDGEVLEGSAAVDESLVTGESLPVRKTPGDELRGGTVVTDAPIVLGVGDEAES
    TLDRLVSLLWSIQSARPGVQRLADKLATVFVPLVVALAVSTAAVLLATGSSPSTALLIGLTVVIVSCPCALGLATPLAIA
    AGVQAAAKRGIVVAAETIFEDAPDVDVVVLDKTGTLTTGKMAVEGVHVVDGTDSDELLRRAGAVESLSEHPIAAAVVEAA
    PVAAADGIGDPATGTDGSAVDSFERADRGVSGVVDGDRVVVGHPDFCRERGLSVPDSLESPIEDARAAGRVPVGVGWDGR
    TRGVVAVGDSEREELDAALESLSSGREIVVLTGDEGPAAERFRAVDGVDEVFAGVPPEAKAETVDRLRRRGTVAMVGDGS
    NDAPALAAADVGIAMGGGTQLATDAADAVIVGDDLEAVGETLEITASTHRRIRQNLGWAFCYNAVAIPLAVAGLLNPLFA
    AVAMAASSLLVVLNSSRSLR

    >gi|284163777|ref|YP_003402056.1| DSBA oxidoreductase [Haloterrigena turkmenica DSM 5511]
    MSGTADSTDRLELYADYVCPFCYLGTRSLEQYREEREAPLEIDWQPFDLRSGKRNPDGSIDHEVDDGKDDQYYEQAKQNV
    RRLQEEYGVEMNQIMATEVDSLPAQQASWYVKQEYPEQWAAFDEAIYQALWQDGRDIGDADVLADLAESVGLPIDEIRSA
    VEDDGLRTELEDRFQAAQRRGITGVPTFVYEDHAARGAVPPAQLERLVEGAEQAQR

    >gi|284163783|ref|YP_003402062.1| protein of unknown function DUF255 [Haloterrigena turkmenica DSM 5511]
    MDDQTRVEWRDWGEDAFDEAAEADAPVLLSLTATWCDHCHEMDAKTYAEPRIAANINDSFVPVRVDVDRHPRVRDRYNMG
    GFPSTVFLAPDGTVLTGAGYLGPDGMRQVLDSVRTMWQTKGSGAGRVPRPLRENNPPAGRLTSDVESAMLGQLTEAYDEV
    AGGWGGSPKFPLPDALEFALKRDREMALRSFDAVSANLLDEYDGGFYRFAAERDWAGLQHEKLLDSNGALVRAFANAYLL
    TGKDEYRDPADRTVDYLTTTLWNDEADAFANSQAPGEDDAHVIDATDRSMADEPPVDDGVFAGPNGLAIEGLLTYHAYTD
    DERARRYAERALETLREDLLEDGVAVHALEGDAERDADGEPIPLLANQARVLSALTTTASVLETDALADATGVADATIDR
    LRDEESFLDGPASGAGLLDRPLRPLDSNVALADALLELAVLADEERYREVARETLEAFAGASDRFGVQMARYATTVSRLL
    EGPLVIRVAADPGTDLHRAALRMADHEKVVVPAAADLEAGLARVERGDQRSDTAETPAELSERVQSVLE

    >gi|284163846|ref|YP_003402125.1| glutaredoxin [Haloterrigena turkmenica DSM 5511]
    MVTLYQLEGCPYCELVADRLDELDIDYDSVWVEGLHSKRDEVKRISGQRQVPVIVDDEYGVTMAESERIVDYLEQTYA

    >gi|284164210|ref|YP_003402489.1| heavy metal translocating P-type ATPase [Haloterrigena turkmenica DSM 5511]
    MSDTSSSAPDAPPDASRSLELRVPDMDCPSCAGKVTNSVERLEGIDAIDARVTSGRLVVEFDPTRTDEDAIRERVRAAGY
    EIVGAASELTFSVPDMD
    CASCASKVENALEGTAGVGEIETRPASGRVTVTVEDGTGSETVVDAIGSAGYDATPMGDDTDG
    EPMGDEPVWKSRRAVTTGIGAALLGLGMLLEFVLPSANPALFSIAAGDLVDRTYHLSTGLFLVTAAIAGAPILRNGYYSA
    RNRSLDIDFLMGVGILASVAAHHPFEGAMLAVLFSVAELLERFSMDRARDSLRELMDLSPETATVKRADGSEETVPADEV
    AVGDTVVVRPGEKIPADGVVLEGESAVDQSPITGESVPADKTAGDEVYAGTLPESGYLEVEVTSEADDSTIARIVRMVED
    AEREKTQRERFVDRFASVYTPIVVTLAVAIAVAPPLLAGASWNVWFLRGLTLLVIACPCAFVISTPVSVVSGITSAARNG
    VLIKGGRYLEAVGESDVLAVDKTGTLTEGDLTVTDVIPLEGADEDDVLRRAGAIERRSEHPIGQAIVDYAEEQGVTADAD
    DDPDVSAFEALTGKGVRAEIDGATHYVGKPDLFDGLADLEHTHATTDGGVALEEMGYDSSSQCDRPGCVDVLAEVIPDLE
    ADGKTVVVVGTEDRPLGVIAVADRVRPEAKWAVSQLQEQGVRVVMLTGDNEGTARAIAEEVGIDEYHAELLPDEKLEWIR
    RLEGEDDAGEGDGDEAPGEEATVAMVGDGINDAPALATAGVGIAMGAAGTDTALETADVALMSDDLTRLPYLYELSHTAT
    GVIRQNIWASLAVKAALAAGTPFGFVTVIHAVVIGDMGMSLGVTGNAMRLANVEPETPEGLESRRADQ

    >gi|284164229|ref|YP_003402508.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haloterrigena turkmenica DSM 5511]
    MPETGDAAPDFTAPLANGDIEEFTLSDRLGDEAPIVLAFFPGAFTGVCTTEMCTFQDRIAAFNDLDASVYGVSRDSPFTL
    NEFREQNGLEFGLISDYNKEIIDDYGIEMDFADLGVYGVAKRSVFVVDGDGEVAYSWVSDDPGVEPDYDEIEAAVEDLA

    >gi|284164312|ref|YP_003402591.1| OsmC family protein [Haloterrigena turkmenica DSM 5511]
    MLRDTYIALACVAPLRVEYLMSITHGVDVEQLGQAVETITEEPEGGQFRFRAKTEWTDGLQCVTTIDDFDQAGERVHTQE
    FHVKGDEPEQILGKRSAPNAVELLLAALGS
    CLSVGYAANAAAMGIELRDLRFELEGDVDLRGFLGISEDVRAGYNTVTCT
    AYIDANASEEELAELRDRVEATSPLLDNITNAVPLETDVVPVQKGE

    >gi|284164313|ref|YP_003402592.1| Methyltransferase type 11 [Haloterrigena turkmenica DSM 5511]
    MSKSLDVDKLEREVKTVYRNVAEAPTDEHHFEMGRPLAKRLGYPASDLDRVPAEAIDSFAGVGYHFDLADPQEGEDVLDL
    GSGSGMDAFVAALHVGDAGSVTGLDMTDGQLAKARRLRDEAGMENVSFEQGYIEDLPFADESFDVVVSNGVINLSAEKEH
    VFAEVNRVLGPDGRLALSDIISETRMPESIKSNADLWAA
    CIGGAEQVTAYTDMIETPGFEDVKVRENPQYEFISDQATNA
    CQKYGVKSISLGARKNNQ

    >gi|284164718|ref|YP_003402997.1| OsmC family protein [Haloterrigena turkmenica DSM 5511]
    MMPERTVTARNPEGMGGTIEAGSFEWRFDEPESAGGSETGPTPVDVFLGALASCLSLSVRFQANKRETPVETIEVTTEAE
    PERGSVDRLEATIRLETDADDETVDRLVDFGERGCHVSQLVDEETPMDVSWERL

    >gi|284164810|ref|YP_003403089.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haloterrigena turkmenica DSM 5511]
    MVLKESDTELDAGDPAPDFELEGADGEMHALEEFADNEALLVVFTCNHCPYAKAKFDLLNELADEYDDVAVVGINPNDAD
    EYPDDSIAKMREYVEDGTIRYDAYLRDESQAVARAYGAVCTPDPFLFAWSDADEEFQLVYQGRLDDALNPDDEPTRFQIR
    EAIDAVLADESVDLEWQPSQGCSIKWTDD

    >gi|284164954|ref|YP_003403233.1| hypothetical protein Htur_1675 [Haloterrigena turkmenica DSM 5511]
    MSLETMEPNPAWDEASYEDAIDTLEAHNDELVYKVWGGDWCKDCRKLLPDFGAALDAAEVPEDRIEEIAVDEDKQGPGVE
    EYGIEYIPTVVVLDDDGEEVTRFVEEEDQPPAIWLAQRLEDELA

    >gi|284164956|ref|YP_003403235.1| protein of unknown function DUF255 [Haloterrigena turkmenica DSM 5511]
    MTDPTTRNRLEDEESPYLRQHADNPVNWQPWDEDALEAAKERDVPIFLSIGYSACHWCHVMEDESFEDDEVAAVLNENFV
    PIKVDREERPDIDSIYMTVAQLVSGRGGWPLSAWLTPEGKPFFVGTYFPKESQRNQPGFLELCQRISDSWESGEDREEME
    HRADQWTEAAKDRLEETPDDAGTAGGAAEPPSSEVLETAADAALRSADRQYGGFGSGGPKFPQPSRLHVLARAYDRTGRE
    EYLEVVEESLDAMAAGGLYDHVGGGFHRYCVDKDWTVPHFEKMLYDNAEIPRAFLAGYQLTGEERYAEVVDETLAFLERE
    LTHDEGGFFSTLDAQSEDPETGEREEGVFYVWTPDEVSEVLEDETTADLFCARYDITESGNFEGRNQPNRVRSLESLADE
    YDLAEAEIEDRLEDAREQLFEAREQRPRPNRDEKVLAGWNGLMINACAEAALVVGNDEYADQAVDALEFVRDRLWDEDEQ
    RLSRRFKDGNVKVDGYLEDYAFLARGALGCYQATGDVDHLGFALDLARTIEAEFWDEEQGTIYFTPESGESLVTRPQELT
    DQSTPSAAGVAVETLLALDEFAEDDFGEIAATVLETHANKIEANSLEHASLCLAADRLEAGALEVTVAADELPAEWRDRF
    ADEYHPDRLFALRPPTAEGLEAWLDQLGLEEPPAIWAGREARDGEPTLYVCRDRTCSPPTHDVEDALEWLGDNAAVEGSS
    ADDPSLGDDESPF

    >gi|284165146|ref|YP_003403425.1| iron-sulfur cluster assembly accessory protein [Haloterrigena turkmenica DSM 5511]
    MSTDSMDGGETETRPEIEVTEDAAEQALSLLEGEGLDDGEAGLRLFVQQGGCAGLSYGMRFDDAPDEDDTIYEHHDLRVF
    VDPASLKYIEGSVLDYEDGLQAEGFHVENPNVVSECGCGESFRT

    >gi|284165288|ref|YP_003403567.1| alkylhydroperoxidase like protein, AhpD family [Haloterrigena turkmenica DSM 5511]
    MREIHRREKMVTTETRAEIEEYLGRVPSWIDALPEPAADHSWGIVRDLELEETELEGREKALVALGAASAMQCPYCVHFH
    REEAKLEEVTDEELSEAIGVASSVRYFSTVLHGAEIDHETFVSETKEIVDHVRDQQAAAPSDD

    >gi|284165469|ref|YP_003403748.1| heavy metal translocating P-type ATPase [Haloterrigena turkmenica DSM 5511]
    MADSRDQFAVGGMSCSFCAESIRKAYDRTDGVEDADVSLAHEEVRVRYDDDRVSEIELKDTLRDLGYTIRDPDKRERFRE
    QQAELEAGKRRLALAGGASAVTAGLMLWMIVVVGRFESDSLAMDLVALGLALGTMFGPGRYILEKAINSLRRGIFNQHVL
    LEAGAFGGLLGGLLGLTVFPAFPTVHFFAVSVFVTTYHVLSGYTSLLVRTRASRAVQDLLELRPDTARRVTDDGVEEVPV
    ADLEEGDRVRIKPGESVPVDGAVREGESTVDESVATGESVPEEKTPGDEVIGGSVNETGTLLVEVTATGDDAFLNRVARE
    IEAARATKPGIVRLADRVLRYFVPGVLLIAALSFLFWLVVPAVWSGGPFGTGPNVQRGAFAALAVLVLGYPCALGMATPL
    ALVRGGGAAARRGVLLRSADAFQLLPDIDRVLLDKTGTITAGEPTVAEIASFGDDRTDTDVLATAATAEAFSEHPLADAV
    LECAGERDVAYDDPDAFDSVTGTGVRATIDGDEALVGKPDWLASAGVDVSSAAGDLERLRDRGLTVSGVARDGDLIGLLG
    IGDEIKDDAAATVRRLRDAGIAPVMITGDDERTARAVADAVGIDRVLADVLPDEKRDEIRRLQAAGHRVAMVGDGINDAP
    ALTQADVGIAIGAGTDVAIESADVVLVGERLGGVVDAYEIGRESYRKTRQNLLTAFAFNGIGVAAATTGLVHPVFAMIAM
    VLSVSAVLANSFAGQLLSGDGVNASFAVRDDSRAAD

    >gi|284165579|ref|YP_003403858.1| glutaredoxin-like protein [Haloterrigena turkmenica DSM 5511]
    MTDMEFPPNQGLDQEEVDEQVEDVIENNEVVLFMKGTELMPQCGYSRKALGLIDSHRDEFETVDVLDSLGEFRTALENHS
    GWETIPQTFVDGEFVGGSDVLEELEERDELAETLNAE

    >gi|284165596|ref|YP_003403875.1| peptide methionine sulfoxide reductase [Haloterrigena turkmenica DSM 5511]
    MADSNANGTASTIQSLERDAGTVPSNETATATFGAGCFWGPDARFGAVEGVVRTRVGYAGGTTPEPSYYALGDHTEVVQL
    EYDPDELSYDDLLETYWSIHDWASTAPKRQYRSVVLAGDDDQYETAVSRRTALEDRAGRSAATDVERLEEFTRAEEYHQK
    YELRSTPVVGDELEALYSDAFVDSTVVARLNGFAAGHGDPAQRDELLAALDLPPTVRTELRRRF

    >gi|284165695|ref|YP_003403974.1| glutaredoxin [Haloterrigena turkmenica DSM 5511]
    MADITMYELPGCPYCAKVRSKLDDLDLEYDVIEVPRSHDERTEVEKVSGQTGVPVITDEENGVEGMSESDDIVEYLEETY
    GEGAA

    >gi|284165709|ref|YP_003403988.1| thioredoxin reductase [Haloterrigena turkmenica DSM 5511]
    MSEQPRVEIYTKEDCPYCEKAKDLFDSKDVEYETYNVTGDDDLFEEMVERADGRKTAPEVFIDDELIGGWDDTSALDETG
    ELDEKLGIADDVEDGEVLEHRKLIIAGTGIAGLTAAIYAGRSNNEPLVIEGDEPGGQLTLTTDVANYPGFPEGISGPELV
    NNMKEQAKQFGAELENGIIESVDSDQRPFRVELTNGDVYTADAVIAASGASARTLGIPGEDELMGYGLST
    CATCDGAFFR
    GEDMLVVGGGDAAMEEATFLTKFADTVYIAHRRDEFRAEDYWVDRVHEKVKEGEIEIMKNTEVIELHGSQEEGVDHVTLV
    ENDQGHPTDRLDDPETDEFEFDVGAVFFAIGHTPNTDYLEGTGVEMDADGYLKTKGGDGGGQTETHVPGIFGAGDVVDYH
    YQQAVTAAGMGSKAALDADEYLEDVERADSSVEEVEPAAADD

    >gi|284165838|ref|YP_003404117.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haloterrigena turkmenica DSM 5511]
    MLDVGDEAPEFELPNQHGETVRRSDFEGERLVIYFYPRANTDGCTTEACAFDDAKPDFDDRGVNIVGISDDPVADLESFA
    DEYDLAFDLLSDELGEVATLYDSYGEKQMFGNTFDGVFRNTYVVGPDGRVEAVYEDVTPEGHAEEILADLEESSTELAP

    >gi|284165957|ref|YP_003404236.1| methionine-R-sulfoxide reductase [Haloterrigena turkmenica DSM 5511]
    MEHDTSDQPRDDADGDLPDSDAEWRDRLSEEEYRILREAGTEPPFSGEYVDHKADGTYACAGCGAELFDGDTKFESGCGW
    PSFYDVDDDRVETRQDNSHGMRRTEVLCANCGGHLGHVFEDGPDPTGKRY
    CINSVALEFDDE

    >gi|284166005|ref|YP_003404284.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Haloterrigena turkmenica DSM 5511]
    MEEYDFLVIGSGSGLDVANAAARRGQSVAVVEKGRLGGTCLNRGCIPSKQLLYRAEVLETIERAEEFGIEATVDGVAFAD
    IVREVNEDVGESSESIRRGLESSSQHDLYPTEGKFVDERTVELSGGDHDGKRLTAETVLVAAGTRPGVPQVDGIEDVDYL
    TSREALRLEERPDHLVVIGGGYIAAELGQFFGTFGSDVTVLGRRPHLLPDADEEVAAEFTDRFADRFDVYTGYEATAVSG
    SDGEVTVEARPYREPDEDAATAMGEAETEDGAEPVTVTGDELLVAAGRVPNTDTLNVDAAGIETDDVGFVETDEYLQTTA
    DGVWALGDIVGEYLLKHNANHEAKAVVRNLFGDDLEPVDYSAMPFAVFSSPEVAGVGATEGELQAAGRDYAKRTYRYEDT
    ARGSAMKAEGMVKPLISLEGEILGCHIVGPDASNLIEEVVVAMTAGSGTVQDIRESVHIHPALSEVVQRAFSGQFTRGGH
    DHEHGHDH

    >gi|284166010|ref|YP_003404289.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Haloterrigena turkmenica DSM 5511]
    MRAIDYQSMTDTFVIVGGDAAGMAAASKARREDPDLEIVVFEKGEWVSYGACGLPYYVKGEIQSLESLVSVTPEEFREER
    DIDLRTGHEVVEIDPDARTVTAEGDGGEVVQPYDHLLLATGAEAVAPPIDGTELEGVYTLGSMSDGKELREYVARARDGE
    SFQQADRGPACRYLEDCSGPVGVVGGGYIGLEMAEALAANGFEVHLFQRSDRVLTGFSEATSEAVADHLRERDVALSLGS
    EVLELAGSEASEASDGASSDRTQSDDAAEVEAVVTADDRVPVEMVLLGTGVRPRTGLAEDAGIELGPTGAIATDAYRETN
    RPDVYAAGDCAEATHVVTGEPTHVPLALTANRHGRAVGQTVTGTPVEGGGVAGTAAVKVFDVEAARTGILDHDEARAAGF
    EPVSETITAKSRAGYYPEGGEVTITLTADRDSGRVLGASLVSEYGEGAVHRSHAIVAALTEGTTVSELENYDLAYAPPFN
    TTWDPVLVAAKVLGGDLRE

    >gi|284166300|ref|YP_003404579.1| nitrite and sulphite reductase 4Fe-4S region [Haloterrigena turkmenica DSM 5511]
    MSDAPHVVSSSWLEAHRESVTVVDVREERDYEQLGRIPGAVNVPTKAFRDPSSVAEGKLPGAAAFADCMSEAGIERGDSV
    VAVDDERGVNAARFLLTATVYGHEGDLYLLDGGLEAWLEEIEADLETAAPGTESTPTLTAYEAARRDDAPIVDREGVEAA
    VEGDAVVVDTRTAAEYDQSHIPGAVQLGWEALLEDETGRLKPEDELESLLADRGIAPDDRIVLY
    CNTARRLSHTYVVLRH
    LGYENVAFYEGSLTDWVRAEAPEWDPVDLKRQVRAYADAGGFDAMVAELGEDVLNRLKLIGLYHQKQRGYFMLRTRAPGG
    ILTAEQARVIGEVADEFARAPEAYGGPDQNPVFGDGYLDATTRQDIQMHWIRIEDIAEIWDRYDEVGLETMQACGNSVRN
    VVGCPAAGIDADETIDVRPTVERVSERFLGDHPYANLPRKFKVSITGCHEDCARSGIQDLGLTPAVKDGRDGFVARVGGG
    LSDGPRVASDIDLFVEPEQVDDLVAAMADLFMDRGSYLDTAVNRLRFLVEELGPERFRAELESYADFAFESPDEALTTDY
    RGDHVGVHEQDDGRSYVGLNVPTGRMGGDEFAELARLADDLGDGELRLTPNQNVLVPHLADDALEAFLDEPVVERYSPDP
    GPFTRGIVTCTGREFCNYGIIETKNRAIRWARELDDWAEEVGIADDHDAIRVHMSGCSASCAQPQVGDFGLRGEVYRDDH
    ESGRAADLGLGGDLGDDEFIDWLVGKIPIDDVPDVIRETMLAYESDRGAGESFADWIDRKSDAELREIVTERPRTDPPAV
    GTEVS

    >gi|284166307|ref|YP_003404586.1| Methyltransferase type 11 [Haloterrigena turkmenica DSM 5511]
    MTGNDTTTDDATDTPRDQRTHVRERYAEVASADGDCCDASTTDADCCDDPAADDDTETECCDTSETDSGCCDASNGEFDL
    EDDPSRALSLGYEPADLEAAPEESNLGLGCGNPVAISNLEAGETVLDLGSGGGFDCFLAAREVGPSGRVIGVDMTPEMLE
    RARENAAEGEFENVEFRLGEIEHLPVADATVDTIVSNCVVNLSPDKGQVFAEAYRVLRPGGTLAISDLVATEPLPREIRE
    NPDAVDA
    CVGGAATIDELEPLLDDAGFVDGSIALEGEWTADLPVASARIEARKPV

    >gi|284166371|ref|YP_003404650.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Haloterrigena turkmenica DSM 5511]
    MTEPLEYEVVVIGGGPAGLTTAIYTTRLGHRTAVFEKEGGRHAAVSHVHNLLGVSENVSGEQLATHAVDQLEHYGGDFFP
    GAVESVARLDSGDGGDDDTDCTDAGGPRFRLESTHATVDARRVVFATGFRDRSPDVPELERFTGRGLHY
    CLHCDAYTLSD
    GSVFVLGHTESAAHVAMSMLNFTADVDLLLDDREPEWDDETDAQLRAHPLEVIDTAVVSADADETIPEDEPPWLGGLSFA
    DGTERDYLGGFAMYGSTYNADLAADLGCDLREDGAIAVDENREASVDGVYAVGDVTHGQNQTTIAVGDGAYAGLAIHKDL
    RPFPKSVAELEALEGEGEGGSDGEGWGEGTLEDGVPGAAADLRARMRRVRDLETHPGLRGPSPGRE

    >gi|284166424|ref|YP_003404703.1| beta-lactamase domain protein [Haloterrigena turkmenica DSM 5511]
    MVTTLSADRLAELVDGDDAFALVDTRPEDSYESWHVPGAVHFPFGPEEELDDRLEAFEDAVGDVDRVITICAKGISSGNL
    AARLESATDAYDVATVDGGMTGWSGVYEHVEIDVGGDGSGAATDAPTIVQLQRRAKGCLGYVVGCPATGEAIVVDPTDDI
    DEYEVAAEEADLTIAGVVDTHVHADHVSGGRELADSLAVPYYLGARAADRGVDYEFTPLERNEVLDVGDLEIKALSAPGH
    TSEMITLLVDGAALLTADTLHVDSVGRTELEFSESEAGSASEAASSAERSSADSHAAMPRDDGETASHEGAEGAEMLYET
    LHRTLLAEPEDVVILPGHVTVTASGEFEHSRPGEPVATTVREARTGIDLLDLEEEAFVERMADVGEKPANYEAIIDLNRG
    REERPPEDRTELELGPNNCSA

    >gi|284166456|ref|YP_003404735.1| uncharacterized peroxidase-related enzyme [Haloterrigena turkmenica DSM 5511]
    MTESEADDAVDPELRDDAMKRFPVPDLEDLPEDLRERIAEETERAGFTPNVFAAMAYKPSQFRAFFDYHDALVEDTALER
    EEIEMIVVAVSGVNHCYY
    CNVAHGALVRIYAEDPLLADQLVANYRTADINDAHRTMLDVAVKLTERPTEVEPDDLEALLE
    AGFSEEALWDIASVTAFYNLSNRLAMFADMRPNEEFHTLGRE

    >gi|284166471|ref|YP_003404750.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Haloterrigena turkmenica DSM 5511]
    MVHVAIVGAYGSAGVAVADELVERRGELSDLELTLIDDGDPGGGLCILRGCMPSKDVLSAGQHRYQARHDDRLEGVPDVD
    PEAVVTRKDDHVSGFAEHRREHVHELAEREGVELLRETARFVDDRVLAVSDRRIEPDYVVVATGSSPNIPDLPGIDDVPV
    RTSADVLDATAFPDSGIVLGNGYISLELGPYLSEVGDVDLTVIEHDERPLDAFPDAYGDTLLEIYREQFGIEVLTTTDER
    RLEPTANGGVRLFAERAGDGGRGDGGEELAVEADELYCFTGRNPTLEGLDLENTRLDPGDGWVGSTMQATDDERVFVVGD
    ANGREPILHVAKEQGFAAAENIVHHARGEDLEPYANVPHHVIFSGLGVYPVARVGHTPATAAESGMDTFVVTREASSDGV
    FATKDHPEGRATLVIDADNGAVLGYQGVHLHADVMAKTMQVVVEMGLDVREVPDRAYHPTTPEILDGLFREACAELEDRQ
    QCVGPDSRDTAL

    >gi|284166526|ref|YP_003404805.1| UBA/THIF-type NAD/FAD binding protein [Haloterrigena turkmenica DSM 5511]
    MSDLRLDATQLDRYSRHVIMDEIGPEGQQRLLDASVLVVGAGGLGSPAIQYLAAAGVGRLGIVDDDVVERSNLQRQIVHG
    DGDVGRPKVESAADYVDALNPDIDVETHETRITADNVGDLVSGYDIVLDASDNFGTRYLLNDHCVLTETPLSHGAIYRFE
    GQVTTFTNERGDGVDDSPPCYRCIFPEAPEPGTVPD
    CATTGVLGVLPGTVGCIQATEVVKYILGKGELLEGRLLMYDAMA
    MSFEEVPIQSNPTCPVCGDEPEIESVEDVSYEGSCEISAD

    >gi|284166750|ref|YP_003405029.1| periplasmic binding protein [Haloterrigena turkmenica DSM 5511]
    MRIVTTLPSATETVAALGIEPVGVSHECDYPPGVESLPSVTDSRIDADASSGEIDQQVLETADDGGVYDVDTDLLESLEP
    DLIVTQGMCDV
    CAVDEVVMEDAVEEIDADPEILTTDPHSVDDVLEDLERIGRATGREERAREVRANLESRIDAVRERTAD
    ALEPNDRPRVAIFDWTDPVMVAGHWTAELVEWVGGEYGLADVGQRSSPREWADIREYDPELIVVAPCGFGLEQTAANTAD
    LTEREGWDDLTAVREGRVWAMDGHHYLNRPGTRLVDTLEALASIVQPELFDEETPPVALEEIAVPFEQLTDRLEAEA

    >gi|284166796|ref|YP_003405075.1| Thioredoxin domain protein [Haloterrigena turkmenica DSM 5511]
    MTVTLKDFYADWCGPCKTQDPILEDLEEDWEGRFEVEKINVDEQQDVANEYQVRSLPTLIIENDDGIVERFVGVTQRDDI
    EDALESAGA

    >gi|284166837|ref|YP_003405116.1| Rhodanese domain protein [Haloterrigena turkmenica DSM 5511]
    MDGEISPDEVKELLEDGADVLVIDIRDEQSFEHSRIPDSENIPFHELTSRVEELEGEDRIVTVCPHGKASVQAAQLIGSY
    EGTADATVESMEGGLEKYGLKFGLIGSEDETDESVNAESPF

    >gi|284166850|ref|YP_003405129.1| dihydrolipoamide dehydrogenase [Haloterrigena turkmenica DSM 5511]
    MVVGDVTTGTDVLIIGAGPAGYVAAIRAGQLDLDVTLVEKEAYGGTCLNHGCIPSKALITATDIAHDARNAEAMGIHADP
    AIDLAGMVDWKDGVVDQLTSGVEKLCKANQVNLLEGTATFTDEHTARVSHSGEGQGSETLEFEHAVVATGSRPIEIPNFE
    FGDEPVLNSRQALALDSVPDSLVVVGAGYIGMELASVFAKLGTDVTVIEMLDSILPGYDDDLKRPVKQRANDLGIEFEFG
    YTASEWHERADGEGITVAADPVEETAADGGSAEAIEDETGESLELDAEKVLVAVGREPVSDTLDLEAAGVETDDRGFIET
    DSRARTNVDHVFAVGDVAGEPMLAHKGSAEGQVAAEVIAGEPAAIDYQAMPAVVFTDPEIATVGMTESEAEENGFDTVVG
    QFPFRASGRALTTGESDGFVKVVAEEEDGYVLGASIVGPEASELIAELGLAIELGATLEDVASTVHAHPTLSESVMEAAE
    NALGHAIHTLNR

    >gi|284166874|ref|YP_003405153.1| methylated-DNA/protein-cysteinemethyltransferase [Haloterrigena turkmenica DSM 5511]
    MQIRVFDRECGIDDSRIDADAEVIRERVREYEAGERTTFDFEIDYLDGFTGDVMRAMERIPSGETRTYGEIAADLETAPI
    AVGQACGRNPVPVVVP
    CHRIVGADSLTGYAGGLDLKRRLLEHEGAVIPGEP

    >gi|284166924|ref|YP_003405203.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haloterrigena turkmenica DSM 5511]
    MTLDDGDDAPTVTAPNQDGEEVSLEFEEPTVLYFYPKDDTPGCTIEANQFQRERESYEDAGVEIYGVSADDVDSHDAFCE
    AAGLEFDLLADPDGEIAETFDVDLRDSGVTARTTFFLADGEVKAVYENVDPDGHAREVLSDALDDGLVTLPE

    >gi|284166999|ref|YP_003405278.1| hypothetical protein Htur_3743 [Haloterrigena turkmenica DSM 5511]
    MNRRTFLAVSGATTVGLVAGCLGDGGNDATAANEFDYELYSTPSGVDVPLVPVEDAYEWYKNDEARFADARGRAQYDEAR
    IKGAIFSPAEDAGSVDDDPVKEWSKDTRIVTYCQ
    CPHHLSSQRAASLIDAGYEHAYAIDEGLRGWINGGYPLEGSAVDAE
    WQKYEINGTTDSEYAGEMVSLKQLEEDRSEIAPIQDDGSYTIQLYYSGSTDAKFRVETPDYTVEGTLKELTNGTVSG

    >gi|284167097|ref|YP_003405375.1| hypothetical protein Htur_3842 [Haloterrigena turkmenica DSM 5511]
    MYDPVADSEKGEQESLAPRIKSLEGKRIGLFNNGKLAATPLLEVVQERLKDEYPDATIEHYEVEHLNRIKNEDELSSIRQ
    WADEEVDACFGAIGD
    CGSCTKFLVYGVNAIEEGGTPAVGLIDEGFELDWKTNARDFGRKLRFHPLSRVAEVTDKERLREQ
    LTADALEEIVAELTRPRTDEERNGEEIVANGEK

    >gi|284167099|ref|YP_003405377.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Haloterrigena turkmenica DSM 5511]
    MVYDILVVGSGSAGLATGLAAGRRGLDVMLFEKESIGGELVNRHTIENFPGIPGTTGPVLRSTIIEQLEEDTVPITLATV
    EEIHDEEPFRLVTDSGEYHGRTVVIAGGGRPRKLDVPGAEEYDGRGIFY
    CAKCDGPLYAEEIVAVSGSDEWALADALYLT
    KYASKVIVIEEGDRLIAGGSLRERVDAHPDIGTKTGTEIRAVEGDDLLQRLTLVDADGNERSERVGGLYVQQGIEPRGTS
    LAGKMVTTTDCGAIVVDQALETDRDGLFAAGDIRQHSSRTIPAAIGDGITACQSAVRRLEANE

    >gi|284167185|ref|YP_003405463.1| selenide, water dikinase [Haloterrigena turkmenica DSM 5511]
    MTDRSDVADVRLTEYADLHGCSCKVGRSDLDDLLREAGLTESRDELLFGVGEDAAARQLTDDLALVSTVDFFTPIIDDPY
    DFGRVAACNAASDAFATGAVDNLDCLAVLGLPQELTTAAPMILAGIADAIDGMGGVVAGGHTIISPWPFAGGAVSATAPP
    EELLTSQRATTGDRLYLTKPLGTQSAMGALRVSDDEFVDVVAEAAGRSVRTIGDEAVAWMTTPNRAAAVAARDVASAATD
    ITGFGLVGQAEVLADNADVGIEVTRLPVIEGTEGLSALFGYGLEDGESAETSGGLLLSVPPSHTATLESRLDDAGVFYRQ
    IGRVTDGDGVSLRDPTVEPIARAER

    >gi|284167189|ref|YP_003405467.1| DsrE family protein [Haloterrigena turkmenica DSM 5511]
    MASIGFLLTGGPFDSERWRTAYELGRAALNKGHEVTFFHYLDGALVPVEDQTFPDCSDSGLYDEMPTEKFQELVADGAEV
    IC
    CGLCVDARGIDAPNDYPDGVEVGLLPDLADMIGEADRVISL

    >gi|284167264|ref|YP_003405542.1| hypothetical protein Htur_4026 [Haloterrigena turkmenica DSM 5511]
    MTSVEIKYCVPCGLLNPAIETQTRLLNEFGQELDSVTLIPGHGGVFIVTADGETIWEKGVHGADLDLELIVDAINDRLLS
    EA

    >gi|284167342|ref|YP_003405620.1| NADH:ubiquinone oxidoreductase, subunit G, iron- sulphur binding protein [Haloterrigena turkmenica DSM 5511]
    MSSENPQQIDAPPLTEEIAPGTATDPPVGSTDVATVTVDGTTIDVAAGATLLDAIEAVETDDYVPALCSYDRHEIGPRSE
    CRTCMVETDEHGVVPACSFPAEDGLTVQTGAADAAEARDVNLDLVLSDHNLRCTTCGKNGRCELQDAAIEQDVEEPRYGV
    RDDRDDYEPIDDSSSFIQIDRNK
    CILCNRCVEACNDVQVEGVLRMEGSGQDTRIGFQSDAETMEESTCVSCGHCVTVCPT
    GSLVEKGIENATTIPLPGFTQKNSVGKTYESTGTSKGPMTPKKRTEHRLETPTTEMVDSPTDDDTLSDTWDDAQSGGDWL


    >gi|284167366|ref|YP_003405644.1| dihydrolipoamide dehydrogenase [Haloterrigena turkmenica DSM 5511]
    MTDRRTDVLVVGAGPAGYTTAIRLGQLGIDATLVEADAHGGTCLNRGCIPSKAIISAASVAHEARTSEEIGITAEVDVDF
    EQFTRWKDRVVRRMGKAVEKLCKANNVDLVEGRAVFEDRHVARVLDGDGTELERVEFDYAVLATGSRPVELPGFEYDHPS
    VLDAADALSLSSLPNSLVVIGAGYIGMELSTAFAKLGVDVTVVEALESMLPGFPPALVEPVESRAGELGIDCHYKQLAQD
    WRETDAGLVLETESADGQDQFEHEAEAVLVAVGREPVTDTMNLDAIGLEPNNDGFLETDDQCRTDVPHVFAVGDVAGEPM
    LAHKGSAEGEVAAEVIAGRTASFADRAVPSVAFTAPELATVGQTVQEAEDAGHNPIQGEFPLRASGRALTTGHTDGFARI
    VASEDGRVLGGQVVGPEASELIAEIALAVEQELPVEALAETIHAHPTMAESVHEASANALGRAIHTLNR

    >gi|284167434|ref|YP_003405712.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Haloterrigena turkmenica DSM 5511]
    MNEETDTTADVRNVVIVGSGVAGLSAAVYAARADLEPLVLEGPEPGGQLTLTTDVENYLGFSEGVGGMELIQNGKDQATA
    FGAEFTHGTVENATLEERPFELELSNGDTLRTHALIVASGASARWVGADNEDKLMGYGLST
    CATCDGAFHRGDDVLVIGG
    GDSAMEEALFLAKFADSVTVVHRRENLRASEIMADRARDHEDIEFRWNTELEAIHGSHEEGVTGATLVSHPDGYPAEKVA
    TGVDVNRETVDVGGVFYAIGHTPNTEFLEGTAVDRDESGYLHTRTADGRATTETTVEGVFAAGDVADPHYQQAITAAGTG
    SMAALDAEAYLEAFERTEETALEVSP

    >gi|284167435|ref|YP_003405713.1| thioredoxin [Haloterrigena turkmenica DSM 5511]
    MATDARDDVSAQSLDEPIYIDGRSHLEDVTTTHDVVLVDFYADWCGPCQMLNPVLERLAGTTEAVIAKVDVDEHQQLAGS
    FGVRGVPTLVLFAGGEQVEQQSGALPEDRLRSLIEGYTE

    >gi|284167475|ref|YP_003405753.1| beta-lactamase domain protein [Haloterrigena turkmenica DSM 5511]
    MTEINPTELGNRLHDDEDVLVLDIRYRDDYEEWHVPDSVNVDVYDDLTADTEAAKETLADLPEDREIVTVCAAGVISQTA
    TDVLRELGYDAETLADGMNGWSRVHRSDPVPTDLDGTLVQVARPGKGCLSHVLISDGEAAVFDPSHYHEEYEAILEDYDA
    DLVAVFDTHAHADHVSGGAELAERHDVPYSLHPKDALEIDANPIEDGESIAIGSVDVEVIHTPGHSEGSVSFDLEGEALL
    TGDTLFHESVGRVELGVEAGLEDSDVEANAATLYESLQRLLDRPNDAVVLPAHDPGSPEPPVAATLSEVRERNADLERDR
    EKFVETLASDIPDHPPNFERVKRANVGREDVPGEELSELELGPNRCAAE

    >gi|284167494|ref|YP_003405772.1| DSBA oxidoreductase [Haloterrigena turkmenica DSM 5511]
    MGLDQPSRRAFLAGSVVTVGAGGAYYLSRSDDAAHDLSPSFHSSDETSAFGVDLAGKPIMGSPEAPIEIYYWTDFQCPFC
    ERFERETLPELVRNYVGPGDVRIVLIALPYFGADSMTAAVASKCVWEQVRNDDSSAYWDWHAAVFDQQGEKNSGWASTEN
    LLEYTRSVDAVDADALESCLEDRRSELEDAVESDADRATELGVSGTPTFVVFDPESEAAGSLVGAQPLERFEEAIERIED
    A

    >gi|284167502|ref|YP_003405780.1| Thioredoxin domain protein [Haloterrigena turkmenica DSM 5511]
    MTEPTASEPTDDGRPAQKPVQLNDVADYEDLLEEHDLVLLEFVTSGCGICASMEPVLGAVARSAPGAVATVNAGLVPALT
    AEFGVQRVPTLVVLKDGEEVARLDDGFQSADTIVDLLETHAAH

    >gi|284167505|ref|YP_003405783.1| beta-lactamase domain protein [Haloterrigena turkmenica DSM 5511]
    MSNTNFDPAEVARRIEEDREDLFVLDVRNEDDYEEWRIDGSTNVPIYDELLEYDYSGLEEHLDDLPKDTEIAVVCVAGIT
    SARAAEFLREHGFDARSIDDGMNGWGRVHRQYDLEERSGVEGVVQVVRPGTGCVSYLAHDGDEAIVVDPSQYIDQYLNAA
    DERDLEIVGVADTHAHADHVSGARRLAGELDVPYYLHGDDAGDLENVTGLEDGETIPVGERDLEVLHTPGHTPGSVSLRY
    GDALLSGDTLFLRSVGRPDLEDGAEEAVREAASQLFDSLERLTGLEDGTVVLPGHFSDESVRPLATELGELRAETTNELL
    SYVTDGDEAAFVETIVESLADEPANYNEIKQINWGKEQPGGDVEALELGPNNCAAN

    >gi|284167527|ref|YP_003405805.1| protein of unknown function DUF395 YeeE/YedE [Haloterrigena turkmenica DSM 5511]
    MIEIAMPAELVAQAVPAEPFPNGIARYAIGGLLVGLGAVVIYLGTGIAAGASTFLESTLSYVSDRSRFQQYRASRDWRVV
    FTLGIVLGAAVYAAVWQGGAWTTNVQPWRLLVGGVFVGIGTRIGKG
    CTSGHGVCGVGSASKTSIVGVITFLTVAIVTAQL
    VQAIGMSP

    >gi|284167528|ref|YP_003405806.1| beta-lactamase domain protein [Haloterrigena turkmenica DSM 5511]
    MDDMDLPMPDVEVESVSPDGLKERIDAGEAVTLLDTRMESEYDEWRIEGENVESINVPYFEFLDDEIDDDVLAQIPNDRE
    ITVL
    CAKGGSSEYVAGTLKERGYDVDHLEDGMNGWARIYERVEVDRYDGAGTLYQYQRPSSGCLGYFLIDGDEAAVIDPL
    RAFTSRYLEDADDLGVDLQYAIDTHIHADHISGVRSLDAVGVEGVIPEAAVDRGVTYADEMTLAADGDEFQVGSATIETV
    YTPGHTSGMTSYLIDDSLLATGDGLFVESVARPDLEEGDEGAEDAAKQLYESLQERVLTLPDDTLIGGAHFSDAAEPADD
    GTYTAPVGQLTAEMDALTMDEDEFVELILSDMPPRPANYEDIIPTNLGQQEADDEEAFELELGPNNCAASQESLADD

    >gi|284167531|ref|YP_003405809.1| thioredoxin [Haloterrigena turkmenica DSM 5511]
    MATDARGGAAGEPIDEPLHVESEAHLEDVTAEYNVVLVDFYADWCGPCQMLEPVLEGLADETAAVIAKVDVDEHQQLAAT
    YGVRGVPTLVLFADGEQVEQHTGALPEDRLRELIDDYAE

    >gi|284176214|ref|YP_003406491.1| Thioredoxin domain protein [Haloterrigena turkmenica DSM 5511]
    MDDPTKPTHLETGDDLDAFLERHDVALVEFYTSGCSLCQAMEPVLGNVARATGIPVALINPGDDIGLVERFEIRSVPTLI
    LFSDGEEIDRRAEGFVGADDVVAMLEDDVPEAVDAA

    >gi|284176229|ref|YP_003406506.1| peptide methionine sulfoxide reductase [Haloterrigena turkmenica DSM 5511]
    MERATFGGGCFWCVEAAFKELEGVQSVTSGYAGGHTEDPTYKAVCSGKTGHAEVVQIEYDPDAIAYVDLLEVFFTIHDPT
    TKDREGPDVGSQYRSAIYAHDDDQLETAEAFAEELENEGLYDGIVTEIEPLETFYEAEEHHQDYFEKNPNDAYCTMHAAP
    KVEKVREKFAENVEGEPTSA

    >gi|284176253|ref|YP_003406530.1| Redoxin domain protein [Haloterrigena turkmenica DSM 5511]
    MRRRELLAGLGSAGVVVGGGAAAVYGLPSVDRLLDENEDDSREPIEIETIDAPGSDAGTVPIPDLGRVTFVDFFGTWCGP
    CIEQMPALGEAAAQFGDEVLFCSVTNESISEAELADWWDEHGGSWTVGIDPAAELSSEYPGGVPRAVAIDDGGSVQWSST
    GTKSADELVAGIEQAIAESDVESA

    >gi|284164071|ref|YP_003402350.1| Thioredoxin reductase-like protein [Haloterrigena turkmenica DSM 5511]
    MTDGAETDAGFDVDVAVIGGGPAGCSAGVFTARYGLETVVFDRGSSSLRRCACLENYLGFPCGIEAERFLELAQTHAREA
    GCRLREELVDSVAALEGGEFEADGGETEGPANGEGFRLEPRDGDPLTARFVIAATKYDGSYLRELDDDGALFVTEEGADG
    SVERFDRAYPDDDGRTPVEGLYVAGPLAGCGDQAIIAAGHGATVARALLRDLRRADGYWDRFAKRYDWRRYRENRDEEWA
    DPERWVELFETTAPGDRDAEDVRRLAESYAAERDESYLEAETAARRTERGQRRLAETLDDEVLLEAVDDEAIRERAARLE
    GGDERSDTDPNDD