Halorubrum lacusprofundi ATCC 49239 uid58807

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|222475774|ref|YP_002564295.1| heavy metal translocating P-type ATPase [Halorubrum lacusprofundi ATCC 49239]
    MGTTQEQFNVGGMSCSFCAESIEKAYSRTGGVEDVDVSLAHEEVLVRYDDGILSEVKVKDTLRDLGYTIRDPDKAKRYEQ
    QQAELADGKRRLLLAGGASIVVAALMGWMIVVMGRFESASPVMDLVTLGLALGTMFGPGRYITEKAFQSLRRGIFNQHVL
    LEAGAFAGLLGGLLGLFVFPSFPTVHFFAVSVFITTYHILSEYTSLIVRTRASQAVQSLLDLQPDTARRVTDDGNVEDVP
    VDDIAVGDQVRVKPGENVPVDGVVGGGKSTVDESVATGESIPEEKTEGDEVIGGSVNETGTLLVEVTAIGDDAFLNQVAR
    EIEEARAMKPGIIQLADRVLKYFVPGVLTIAALSLTFWLVAPLAWGGGPNVQRGAFAALAVLVLGYPCALGMATPLALIR
    GGGKAANRGILMRSGDAFQIFPDIDHIVLDKTGTITVGEPVVSEIVGVGEGETDVLATAASAEAFSEHPLADAILDHADD
    RGVEYADPESFDSVTGNGVRATVAGDDVLVGKPGWLEAEGVDLSDAGDEIERLQRRGLTVSGVVRDGDLVGLIGIGDELK
    TDAAETVQRIKDAGITPVMITGDNERTAQAVAEEVGIERVMADVLPDEKREEIGRLQDDGERITGSRTSSERRSDGSHRV
    AMVGDGINDAPALTQADIGIAIGAGTDIAIESADIVLMGERLGGVMDAYEIGEESYRKTRQNLATAFAFNGIGVAAATTG
    LVHPVFAMLAMVLSVSAVLANSFGGQLLSGEGVNTEFAVEDEDSTEIGDGQPAAD

    >gi|222475776|ref|YP_002564297.1| mercuric reductase [Halorubrum lacusprofundi ATCC 49239]
    MPSPTDYDLVILGGGAAAFAAITEASRQGLSTAMVNTGLPIGGTCVNVGCVPSKHLLAVAEHGAAASDNPFDAVTYTEEP
    TVDWTEALDGTDEIVERFRQENYVDVAEHFETDIYEGYGQLIDDTTIEVVDGLDKGTRIAGEKALIATGSSPWAPPIDGL
    DDVEYYTSETILDERDLPESISIIGGGYIALEWGQILHRVGVDITILQRSDRILSGMEVQLGREIQRAFREEGIDIVTGN
    DFQQVQSAAADGGTEAIQQGVTVETTVDGDSRVFTAEALFVATGVQPNSQNIGLEALGVETEPDGAIRVDECFQTTNSDI
    YAAGDVIGEPELETVAAKEGNHVVKNAFGDEGATIDYNAVPAVVFTSPEVAAVGTTELEYMNEHGTCSCRTVQMEDVPRA
    KAVKNTDGLVQVVKHHETDEIVGVHMVGPRAADMIMEATLAVKFDLTVDDIIDTVHPFPTFSEAFKQTCQTFRRDTSKMS
    C
    CIE

    >gi|222475901|ref|YP_002564422.1| heavy metal translocating P-type ATPase [Halorubrum lacusprofundi ATCC 49239]
    MGTTHEQFNVGGMSCSFCAESIKKAYARTEGVEDVDVSLAHEEVLVQYDDAILSEVKVKDTLRDLGYTIRDPDKAKRYEQ
    QQAELADGKQRLLLAGGASVVVAALMGWMIFVVGRFESASLAMDIAALALALGTMFGPGRYITKKAFQSLRRGIFNQHVL
    LEAGAFAGLLGGFLGLFVFSGFPTVHFFAVSVFITTYHILSEYTSLTVRTRASQAVQSLLNLQPDTARRVTRNGEIEEVP
    VDDLEVDNRVRVKPGESVPVDGVVVEGNSTVDESVATGEPIPVEKSEGDEVIGGSVNETGTLLVEVTATGEDAFLNQVAR
    EIEEARAMKPGIIQLADRVLKYFVPGVLTIAALSFAVWLVGPLAWGGGPNVQRGAFAALAVLVLGYPCALGMATPLALIR
    GGGKAANRGILMRSGDAFQIFPDVDHIVLDKTGTITVGEPAVSEVVALHGAESGVLATAASAEAFSEHPLADAILDHADD
    RGVAYTDPESFDSVTGKGVRATVDGSTVLVGKPGWLEEAGIDLSAARDEIERLQERGLTVSGVVRDGVLVGLLGIGDELK
    ADATETVQRITDAGIAPVMITGDNERTAQAVADDVGIDRVMADVLPDEKREEIGRLQDDGHRVAMVGDGINDAPALTQAD
    IGIAIGAGTDIAIESADIVLMGDRLGGVMDAYEIGKESYRKTRQNLIVAFSFNGIGVAAATTGLVHPVFAMIAMVLSVSA
    VLANSFGGQLLSGEGVNTDFAVQGSDTSGKDPTTAD

    >gi|222475903|ref|YP_002564424.1| dihydrolipoamide dehydrogenase [Halorubrum lacusprofundi ATCC 49239]
    MTNTDYDLIVLGGGMAGLPVAMKCGYSGMDVALVEEGLLGGTCLNRGCIPTKTMLRSAEVANLARRSEEFGIDIDGAIEP
    DIDAIVERKDDIVESIRKGAYENVESNENIDFVEGHGIFESPHEIRVDDRTLSAETIVINTGARPTRPSIDGLDDVDVHD
    STDLLERASIPPSLAVIGGGYVGCEYAQMYSRFGADVTVFQRGDTLLPDEDPDVSEVIETAFENEEITVQTGTPVTALTE
    TNDGIRVDAGADGTVSVTASDVALAAGRTPNTDGLQLEDIGASLDENGFVETDDSFRTTADGVYAIGDVSGPPMFTHSAR
    DDADLLYRHLAKSEEISTKGRTVPWAVFTDPQIGHVGLTEQEAREAGYEVGVGRQDFADQGKPKALGETEGFVKLVTNAE
    TDELLGAHIVGEQGAEIVHELVLAIELGATADDIANTMHIHPTLPESINSAAGGVHKPS

    >gi|222475905|ref|YP_002564426.1| mercuric reductase [Halorubrum lacusprofundi ATCC 49239]
    MEDNRSYDLVILGGGAAAFAAITEASGRGLSTAIVNTGLPIGGTCVNVGCVPSKHLLAVGESAAAPQKNPFEAVQYSDDE
    PTVDWDEALDGTDALVERFRQENYVDVAEHFETDIYEGYGELVDDTTIEIVDGPDKGIRITGEKTLVATGSSPWVLPIDG
    LDGVDYYTSETILKERNLPGSIVIIGGGYIALEWGQILHRIGVDVTILQRSERVLSGMEGQLGREMQRAFEEEGIKVITG
    NDFQRVRAPAVDGGADAIQSDVGIETLVDGNERTVTGDALFVATGVQPNSEDIGLETVGVEANDDGAILVDEHFQTANPD
    VYAAGDVIGEPELETVAAKEGNHAIKNAFGNEGVTIDYDTVPAVVFTSPEVASVGTTELEYMDEHGTCSCRTVQMEDVPR
    AKAVKNTDGLVQVVKHHETDEIVGVHMVGPRAADMIMEATLAVKFGLTVDDIIDTVHPFPTFSEAFKHACQAFRRDTSTM
    SC
    CVE

    >gi|222475943|ref|YP_002564464.1| beta-lactamase domain protein [Halorubrum lacusprofundi ATCC 49239]
    MVNNITAERLAGKIDADEQFTLIDVRPEDSFEAWHVRDAENVSYDPDEGLSEDQLNEVDTLVDGRPVVAICGKGLTSTPF
    AFELDEHGYDDISVVTGGMEEWSKLYEVVPIETSSDDLVVRQVQRRAKGCLGYVVGSKEVGEAVVVDATRQTDQFKVAAQ
    DAGLSIARVLDTHVHADHISGSPTLADEVGVPYHLGDAARERGVEYEYDPLPDGDVIEVGDVEIEALHTPGHTSEMMNYL
    VDGELLLTGDTLFVDSVGRTELQFGEDDASRGAELLYDSLHETILNLPDDTTILPGHLTVTSDGRYENGSPGEPLEARLG
    DLRDELDFLGLDREAFVERLTEDTPEKPPNYETVIAINTGKETVEDESEATELELGPNNCAA

    >gi|222475960|ref|YP_002564481.1| heavy metal translocating P-type ATPase [Halorubrum lacusprofundi ATCC 49239]
    METRTAHLDVTGMTCANCSGTVGDALESLDGVIEANANFATDEGSVEYDPDEVSLAEIYETIEDAGYGAVSDTVTIGISD
    MT
    CANCVQTNETALEDTPGVIAAEANFATDEAQVRYNPADTSLDALYDAIEDAGYSPVREDSDSGESGEDARDTARQGEI
    RKQLRLTLFGAILSAPMLFFLAEKFLLGGGILPETVFGVEFGWVEFLLATPVQVVLGWPFYKNSYNALVNNRRANMDVLI
    ALGSSTAYFYSVAVLAGLIAGSLYFDTAALILVFITLGNYLEARSKGQAGDALRKLLEMEAETATLVDEDGIEVEVPLED
    VTVGDRMKVRPGEQIPTDGVVIDGQSAVDESMVTGESVPVEKGEGDEVVGSTINENGVLVVEATKVGADTALQQIVQTVK
    EAQSRQPDIQNLADRISAYFVPAVIANAVLWGVVWYLLPATLADFVEVIPLWGLVAGGPVAAGGVSVFEFALIVFASSVL
    IACPCALGLATPAATMVGTTIGAQNGVLFKGGDILERAKDVDTVVFDKTGTLTKGEMELTDVVVFDGDGQPITDGGQLTG
    RDRLSENDVLRLAATAESGSEHPLARAIVDGARDRGIDVSDPDDFENVPGHGIRATVGDSEVLVGNRKFLRDNGIDPSPA
    QETMERLENEGKTAMLVARVPAGTDEGELVGVVADADTVKESAKDAVSQLQERGVDVMMITGDNERTARAVAEQVGIDPE
    NVHAEVLPEDKSDAVEAIQDEGRKAMMVGDGVNDAPALAVAYVGTAIGSGTDVAIEAADVTLMRDDPLDVVKAIRISDAT
    LQKIKQNLVWALGYNTAMIPLASLGLLQPVLAAGAMAFSSVSVLSNSLLFRRYTPDHDYELLGRLR

    >gi|222478570|ref|YP_002564807.1| DSBA oxidoreductase [Halorubrum lacusprofundi ATCC 49239]
    MSNTDAADAPTPDATESITIYSDYVCPFCYLGRQSFARYQETREEPLAIDWHPFDLRAGKRGPDGEIDDTADDGKDEEYY
    EQARENVRRLQEKYDAEMAQELRTDVDSLPAQIVSVHVRETAPESWLAFDEAIFAALWQDGRDIGDREVLADIAADVDGL
    DPEIVDEALADDDLRDRVTDLFTAARERGVTGVPTFAYDGHAARGAVPPEQLERLVGDV

    >gi|222478581|ref|YP_002564818.1| dihydrolipoamide dehydrogenase [Halorubrum lacusprofundi ATCC 49239]
    MVVGDIATGTEVLVIGAGPGGYVAAIRAAQKGLDTTLVEKDAYGGACLNRGCIPSKALITGSGLAHEAGNAESMGIHADP
    AVDMGKMVEWKDGVVDRLTGGVEKLCKANGVNLVPGTASFVDEHTARVAHGGQGQGSESIEFEHAIIATGSRPIQIPGFE
    FAEDHVWSSADALDADTVPDRLGIVGGGYIGMELATTYAKLGADVTVVEMLDDILDPYEDDVKRIVRKRAEELGVEFHFG
    EGASEWSEGADGGYLLHTETEEGEESTYGADKILVAVGRQPVTDGLDVDNAGIETDDRGFIETDDRTRTAVEHIHAVGDV
    AGDPMLAHVASKEGIVAAEVIAGEPTALDQQAIPAAVFTDPEIGTVGMTEEEAEADGFDPVVGEMPFNASGRAMTTGHTE
    GFVRLVADDETGFVLGAQIVGPEASELIAEAALAIEMGATLEDVAATVHTHPTLAEAVMEAAENARGQAIHTLNR

    >gi|222478677|ref|YP_002564914.1| thioredoxin [Halorubrum lacusprofundi ATCC 49239]
    MSDTADATDGGESTKSERERIRERKLRELQEELEREGEIGGEPAEKLGEESTATPDEPIDVAGPEEFRRVVDEHDVVVVD
    CYADW
    CGPCQMMEPTIEAIASDTDAAVAKVDVDANPEIAQQLGARSIPTLLVYADGEAVDRFTGAQDRTTLESAIERAA

    >gi|222478694|ref|YP_002564931.1| glutaredoxin [Halorubrum lacusprofundi ATCC 49239]
    MVMTDLTLYELEGCPYCAKVKAKLADLDLEYESVMVPRSHGKRTEVEEISGQTGVPVLVDEEHGIDAMPESDDIVEYLEE
    TYGDAS

    >gi|222478760|ref|YP_002564997.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halorubrum lacusprofundi ATCC 49239]
    MTDDVVEHRRLIIAGTGIAGLTAAIYAARSNNDPLLVEGDEPGGQLTLTTDVENYPGFPEGISGPELINNMKAQATKFGA
    EARNGIIVDVSKEPAGHFRVELSDGDVYTADAFIAASGASARTLGVPGEDELMGYGLST
    CATCDGAFFRDEDMLVVGGGD
    AAMEEANFLTKFADTVYIAHRREEFRAEDVWIERTMEKVEDGEIELLLNTELTEIHGTPEDGIDHVTLVEHPDGHPTEKL
    DDPATADEVDEYDFDVGAVFFAIGHTPNTEFLEGTEVETDDEGYLLTEGGRGGNQTATGVEGLFGAGDVVDFHYQQAVTA
    AGMGCQAALDADEYLTERERAGELYEPTADAATADD

    >gi|222478808|ref|YP_002565045.1| Thioredoxin domain protein [Halorubrum lacusprofundi ATCC 49239]
    MTVRLLDFHADWCGPCKTQDPILEEIQEDLGDAFELQKVNVDEEQDVANQYQVRSLPTLIIENDEGVVDRFVGVTQREDI
    EAALSEAGA

    >gi|222478842|ref|YP_002565079.1| glutaredoxin [Halorubrum lacusprofundi ATCC 49239]
    MSESPITLYRLQACPYCERVVRMLNELDLEYRSRYVEPMHSERNVVKRVSGARSVPAIVDPETGVTMSESANIVEYLEST
    YAEGGA

    >gi|222478857|ref|YP_002565094.1| UBA/THIF-type NAD/FAD binding protein [Halorubrum lacusprofundi ATCC 49239]
    MSLSLDADQLDRYSRHVIMDEVGPEGQKRLLDGRALVVGAGGLGAPVIQYLAAAGVGTIGIVDGDVVERSNLQRQVIHGD
    ADVGEPKVESAARYVDRLNPDIDVETYETRLDEGNVRDLLAGYDLVVDCADNFRTRYVVNDAARIEGLPVVHGAIYKFEG
    QATTLVPDGPCYRCLFPEAPEPGTVPD
    CATTGVLGVLPGTVGCIQATEAIKLLLDTGETLDGRVLFYDAMDMTFESVPYR
    RNPDCPVCGDDGIETIEGIDYSGGCRVDAD

    >gi|222479012|ref|YP_002565249.1| heavy metal translocating P-type ATPase [Halorubrum lacusprofundi ATCC 49239]
    MSAPDCTLCELPTAGVDVIDDEGNEFCCTGCRDVYETLGDVDVDADAVRERRQGNEDESAADDTEVPVDHEATFLEVDGM
    H
    CATCEAFIETVATQTEGVSAASASYVTDTVRIDHDPDAVSTDDLSEAVSGLGYSAYDRDDAFSRRQADNMATARLAVGV
    LVGMAVMLQYIVIIYPTYFAFPFYNERTLEYLNQAMASSSGTYFFIVIAVLTTVVLFITGKPILRGAYVSAKTRSPNMDL
    LVAIAAVSAYAYSTLAVIFVDSPSIYYDVTVAIIVIVTVGNHYEDSIKKRATELLSDLTAVQVDSARRLVGGGESDGKGS
    ADSENAGETEEVAIDDLASGDRLLVRAGERIPVDGEAVAGDAAVDESVITGESMPVRKTPGDAVVGGSVVADGSLTVEVG
    PDATSSLDRVAELVWDLQSGNHGVQKLADRLATIFVPVVLAVALLAAGANLALGNGVTEAMLVGLTVLIVSCPCALGLAT
    PLAVAAGIRDALERSIVIFDDTVFERLRGADTVVFDKTGTLTTGEMRVVAADLDDGLLRLAAALEERSAHPVGQAIAAVH
    AGGGDLEDAGAVSDPDAASPAVADGGAAESTEPNDTLPVTDFESHARGVSGVVDGIEVVVGHPDLFDERGWAVPNGIREA
    VAAARDVGRVPVAVGRDGAAEGVVVVGDELREGWEETVTALADSGVEVVVLTGDDERAATVFREHDAIASVFAGVPPEGK
    AETVERLKASGQTVMVGDGTNDAPALAAADLGVALGGGTAMAADAADVAIVDDNLDSVATVFELSRAAGRRVKGNIGWAL
    CYNAIAIPLAVTGLLNPLFAAVAMGASSLLVVTNSSRPLLDD

    >gi|222479037|ref|YP_002565274.1| iron/cobalamin ABC transporter periplasmic substrate-binding protein [Halorubrum lacusprofundi ATCC 49239]
    MSDPRVVSLAPSATATVTALGAAEILVGVTNHCDLSEDAGATHGMDSPAALGGWLNPDLDRVADLDPDAVLTSDGLQSDL
    ADD
    CRERGFAVRHREPATLDEVVATFAARGADVGRSEAGDRLAAEARERLDRIAGAVVDRPRPIVYCEEWSDPPMAAGNW
    VPDAVRAAGGRYPFVDPGERSREVDLAAVERATPDHVVVHVCGHGDRIDPATVEERDWAVDAPVHVIDDSLLNQPSPALI
    DGVERLARLFHPEIETYS

    >gi|222479120|ref|YP_002565357.1| Disulphide bond formation protein DsbB [Halorubrum lacusprofundi ATCC 49239]
    MTARPSETTVWLSAATVVATIATAGSLWFSLGLGLTPCDLCWYQRILMYPLVVVFSVATVEKRPAVLRTALPLVGLGLSL
    AAYHSYLQATMTE
    CTLGGPCATVLWQSPGLGLTIPNLSLVAFGVIAVLLVGMWRSAGRR

    >gi|222479231|ref|YP_002565468.1| glutaredoxin-like protein [Halorubrum lacusprofundi ATCC 49239]
    MTFQPETDAEPDEIVARVEETIADNDVVLFMKGNRLMPQCGYSKRAVELIGQHVEEFETVDVLPALPHYREALESHSGWE
    TIPQTFVNGEFIGGSDVLAELDERGELAAELGAE

    >gi|222479262|ref|YP_002565499.1| peptide methionine sulfoxide reductase [Halorubrum lacusprofundi ATCC 49239]
    MSNQLETATLGGGCFWCTEAALEQLAGVESVTSGYAGGHVENPTYKGVCSGNTGHAEVVQVEFDPDVIAYDKILEAFFEV
    HDPTQLNRQGPDVGSQYRSIVLTHDEEQREVAEAYVEALDEEYDDDVVTEIEPLETFYRAEEHHQDYFAKNPDDAYCTFH
    AKPKMEKVREKFEAKVAK

    >gi|222479379|ref|YP_002565616.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halorubrum lacusprofundi ATCC 49239]
    MSDPFVVVGADAAGLSAASKFRREAPDREVVVFEKGRWISYAYCGMPYFIEGRVERMSNLLSLSPSEVEERGIDLRRDHE
    VIAVDSDTKTVAVETAEGETIEQGYDDLLVATGGRAETGSFNVRGLDGAFTLHDMNAAAAIDAYIAEPDAYDPARADVSA
    VDRERVDRNAAMPAPETAAIVGGGYVGVEMAEALSGRGLDVHLFQRSGHLLPPFGEAVGERVADELEAEGVAVHRGTPVK
    SLVGDDRIEGVALDGAADSVAADLAIVGVGIRPNTELLDGTGVETGEGGAIRTDEYGRTSLPDVYAAGDCATAVHAVTGE
    EAWMPLGLTANRAGRAVGATIAGDPSPVGEIAGTAVVKAFDMEAGRAGLVEEETAREAGFDPVRETVTAGSRSGYYPGAA
    PTDVTLVADRDTGRLIGGSIVGPDRAAIRIDTLATALEADMTVPEVERLDLAYAPPFSPVWDPILVAAKVLNGTLDEE

    >gi|222479419|ref|YP_002565656.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halorubrum lacusprofundi ATCC 49239]
    MTDVGDDAPTFTASLVTDEIEPFDLSDRLGDEPVVLAFFPAAFSNTCTDEMEALRDGFERDDCTLFGVSTDLPHALAAYR
    DQYDLPFALVGDPAHRAIEAYDAIESFEHYGVDTVARRAVFVIDGDGVVTYRWLADNSGQEPDYDALDAAVDDASP

    >gi|222479451|ref|YP_002565688.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halorubrum lacusprofundi ATCC 49239]
    MSSSDDEYDIAVVGGGPAGLTTALYGARLGHETVLIDRGGGRAAMMADTHNVIGVTEETSGNEFLATGREQVQSYGGTFE
    RGFVTDVDRTDDDRFRLSTTGAEILSDRVVLATGFSDKRPDPPLPRTGKGLHY
    CLHCDAYMFVDEPVYVMGHGEAAAHVA
    MIMLNVTDDVDILTRGAEPTWSDETAAQLDAHPVEVVSEDVTGVENDPDSGWLEALEFEDGTRREYRGGFAMYGSDYNTA
    LAEGLGCDLTEGGEIDVDDHGRTSENGVFAVGDITPGHNQVPVAMGQGAKAGLAIHKDIREFPRSQETIEADGPVDADEV
    PAISPALMATAVAHEGHAGGARVKGVEAKEETPAADDD

    >gi|222479671|ref|YP_002565908.1| Methyltransferase type 11 [Halorubrum lacusprofundi ATCC 49239]
    MTDDVSAEGGEIDAAEQRHAVRERYSDIATEGSSSSCCDGDVDAAGDTGGSTACCGDTAPESMTPEDESRRLGYDEDDID
    AVASGANLGLGCGNPTAIASLEPGETVLDLGSGGGFDCFLAAREVGPDGRVIGVDMTPEMVERARENVEKNDADTVEFRL
    GEIEHLPVADESVDAIISNCVINLSPRKPQVFREAFRVLGPGGRLAVSDVVQTAPFPDDVRLDPSSVSA
    CVAGAATIDEV
    ESMLTDAGFIEIAIDPKAESEAFIRDWDDDRDPSEYVVSATIEARKPR

    >gi|222479681|ref|YP_002565918.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Halorubrum lacusprofundi ATCC 49239]
    MQEFDFLVIGSGSGLDVANAMAGQGNSVAIVEEGRLGGTCLNRGCIPSKKLLYHADVMKTVQRAGEFDIDAEVNGVDFAE
    IVRTVNEDVSGSSESIRKGLTSSDAHDLFSGTGRFVDDRTVEIVDGDDEGATLRADTVLIATGTRPSIPPIDGIEDVDYL
    TSTEALRLETAPDHLVIVGGGYIAAELGHFFGTFGSDVTIVGRRENLLPEADEAVGEAFTDRYADRFDVYSGYEAVAADE
    SGGEVTVEARPYPEAESVRAGGETVGAPEDAEDVTVAGDALLVAAGRRPNTDALNLDATGVETDADGFVETDEYLQTDAE
    GVWALGDVVGEYLLKHSANHEARAVIRNLLGDEPEPVDYSAMPFAVFASPEVAGVGAREQDLRESDAEYATRTYAYDETA
    RGSAMHAEGFVKVLIDLDGNIEGCHIVGPEASNLIEEVVVAMTAGSGTVADIRDAVHIHPALSEVVDRAFSGQFSRGGGG
    HDHHHHS

    >gi|222479685|ref|YP_002565922.1| protein of unknown function DUF395 YeeE/YedE [Halorubrum lacusprofundi ATCC 49239]
    MLLSPVAYVGVSIAVGLSFGILLQKARFCFVSAFRDFVAFKDTRVLKGLLVGIAVMTVFWSVQATFGYFRGFWTPAWGLG
    SLFGGFVFGLGMTLAGG
    CASGTLYRAGQGYLQFWLVLLFMFVGYVLFAFAFPVAETYYFQTLNPFEGQTLYLSLPFSPAV
    IGVGAVALGTLAYAFVKGRSQLPDDPSGGTGVGTDTRAQAAIGASRTLSAVSLGLRGIADGTVEYGRALASDDRPVTVRL
    RDSWDARTAGVAMALVASLWFYVHGHWAITGSEARWAGYLLAGAGFDVASVDYWGSILFRDGNISLTIDMVMIASLIVGS
    FVAAYASGDFRIRKPKLNRVPNYAIGGLLMGVGSRLAAG
    CNIANLFSGIALLSVHSFIAGAGIILGVYVMTHYMYREVGC
    AI

    >gi|222479686|ref|YP_002565923.1| Rhodanese domain protein [Halorubrum lacusprofundi ATCC 49239]
    MVEELTPDEVNERVQTGDIRVIDTRPPAQYEQGHIPGAINVPLGDLPSQVPDIEWDDTDVVCACPVGQSSKQAAMLISSY
    EGVEEDVLVASMAGGYEEWDFELETGAPADA

    >gi|222479690|ref|YP_002565927.1| UBA/THIF-type NAD/FAD binding protein [Halorubrum lacusprofundi ATCC 49239]
    MSDLDLDPTQLDRYSRHIIMDDVGPEGQKALLDAEVLVLGAGGLGAPIIQYLAAAGVGTIGIADDDEVELSNLQRQVIHG
    NDDVGRKKVDSAADFVAQLNPDIDVRKHEMRVTADNIEELISGYDFVVDGTDNFATRYLVNDACTLAGVPFSHGSIFKFE
    GQVTTFAGGEDSPCYRCLFPEAPPAGMVPN
    CSTAGVLGVLPGTVGCLQATETVKHIIGEGETLDGSMLFFDALDMEFDKV
    EIPKRDDCPVCGDDPAIESVHDVEYSASCAIDIGDDDESEPEIEASD

    >gi|222479721|ref|YP_002565958.1| protein of unknown function DUF255 [Halorubrum lacusprofundi ATCC 49239]
    MSQPTERNRLDGEASPYLQQHADNPVNWQPWGEEAFERAREHDVPVFVSIGYSSCHWCHVMAEESFEDESIAAVLNEKFV
    PVKVDREERPDVDSTFMTVSQLVTGGGGWPLSAWCTPKGKPFYVGTYFPPEPRRNQPGFRDLCERIADSWADPEQREEMK
    RRADQWTTSARDELESVPEPDAAGDASGTGGAGPPGPDLLDEAAAAAIRGYDDEYGGFGSGGAKFPMPGRIDVLLRAYAR
    SGGDAALTAATGTLDGMARGGMYDQIGGGFHRYAVDRQWTVPHFEKMLYDNAELPMAYLDGYRLTGDASYARVASETLGF
    LDRELRHDDGGFFSTLDARSRPPENRRGNAGSDESDDADDVADVEGAFYVWTPAEVDAVLDEPAASLAKDRYGIRSGGNF
    ERGTTVPTIAASIAELADEHDMSTEAVREALTAARVALFEARESRPRPARDEKVLASWNGRAISAFATAGQVLGEPYADI
    ASDALSFCRERLYDEETETLARRWLDGDVRGPGYLDDHAFLARGALDVYSVTGDPEALGFALDLAATVVSDFYDEADGTI
    YFTRDPDGNAGHGGDDTLFARPQEFTDQSTPSSLGVAAETLALLDGFRTDREFAEVAETVVTTHADRIRASPLEHVSLVR
    AADRVASGGIEVTIAVDAVPDAWRETLGERYLPGALVAPRPPTEDGLAAWLDRLDMDEAPPIWADRDAVDGEPTAYVCEG
    RTCSPPETDLDAALEWLAARRRSE

    >gi|222479742|ref|YP_002565979.1| methionine-R-sulfoxide reductase [Halorubrum lacusprofundi ATCC 49239]
    MSETDGHDELTDEEWRERLSEEEYRVLRESGTEAKFSGEYVDHHPEDGEYRCRACGTVLFEAETKYESGCGWPAFYAAEE
    ESVTTTTDTSHGMRRTEVRCANCDSHLGHVFDDGPEPTGKRF
    CINSVAMKYNEE

    >gi|222479776|ref|YP_002566013.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halorubrum lacusprofundi ATCC 49239]
    MVAMESDSELDRGDAAPAFELPGTDGETYTLDSFDADTLLLVFTCNHCPYAQAKFDLLNDLAAEYDDLAVVGINPNDATE
    YPDDSVEAMRERVADGTIAYDAYLRDETGEAADAYGAVCTPDPFLFGRDGDAFRLQYHGRLDDALNPDDEPTEFYIRDAV
    DAVLAGEEVEVPDRPSRGCSIKWPDE

    >gi|222480019|ref|YP_002566256.1| Rhodanese domain protein [Halorubrum lacusprofundi ATCC 49239]
    MDGEIDPDELAALLDDEETETVDADDTDLRIVDIRDRRAFDRGHIPDSECIPFPELTTRIAELEGAARIVTVCPHGVASR
    QAAQLIGSYAGTQNVRVDSLRGGIEAWERDVGALVPTAADGADGGTDPTPDADEGPDAPF

    >gi|222480050|ref|YP_002566287.1| Redoxin domain protein [Halorubrum lacusprofundi ATCC 49239]
    MRRRDLLAGLASVGALGGAGAVATGRVPDAIGGDELGGSEADGDRAEPIEPVTLDTVEAPGSRDGEVTLPMPDRPTFVDF
    FGTW
    CPPCEEQMPALAEAHDRIGDEVLFVSVTTEDVGGAVTEETVANWWRENDGDWLVAADVTAELAARLNVGGYPSARA
    IDASGRVRWATSGTHTTEEFVDGIERALDR

    >gi|222480095|ref|YP_002566332.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halorubrum lacusprofundi ATCC 49239]
    MTMVSTGDAAPTFTATVGTSDHESFDLDDHIGDGPVVLAFFPGAFTPPCTSEMVAFQERVAEFEDAGGTLLGVSADSPFS
    QGAFREKHGIEFDLVSDTAGDAIRAYGLEIDIADLGLYGVANRAVFVIDDDGEIVYDWVSDDPTNEPDYDAVLDAVESA

    >gi|222480105|ref|YP_002566342.1| Rhodanese domain protein [Halorubrum lacusprofundi ATCC 49239]
    MTDDVLVTADWVESNLDAFQDDDSDLRLVEINNPTVTDESEYTPYEEGHIPGALNFEWDEVFTDETERDIVSKADFAERN
    GAAGIDADTTVVVYGGGRVPNWFALFGYWIYTYYGHDDVRVIDGGKGYWVDNDYPLSTEAPDFTSREYEARGPFESVRAY
    KDDIDKAIEEGIPMVDVRSPEEFSGEVIAPEGLNETAQRGGHIPGASNVPIGTTLNEDGTFKSADELRELYADAGVDGDE
    STITY
    CRVGERSSIEWFLLHELLGYDDVRNYDGSWTEWGNLVGAPIETGE

    >gi|222480189|ref|YP_002566426.1| DSBA oxidoreductase [Halorubrum lacusprofundi ATCC 49239]
    MERTRRSLLAGTMSIGVVGAAGCLGGGSDGNDGGNDGGNDGSDSSGVDLDLGQYDCDLTEPENPDLDYRPVIVDPEADVV
    VQAFEDFT
    CGHCATYKLEHFPTIREEYIDPGEVRYEHWDFPIPVNETWAVPVASAARGVGARQGAEAFFSFASTAYESQG
    NYSGEAIGAAAEAAGADPCAAIADAQFSAYEEASMSDRSEGESMGLAGTPTIFVNGEAVADYQAETIAAAIDEAL

    >gi|222480365|ref|YP_002566602.1| Rhodanese domain protein [Halorubrum lacusprofundi ATCC 49239]
    MDDRPTRTSRRSVLASAGAALAATAGCLGSTDSDDEQPSAYTTPAAAEFDGVVDSQWLESNLDDVHLLDARDEEAFSEGR
    IPGAYHFPDSEMLDSYAEETSDGFEVSPEAIAWTLSEAGIEPDDDVVVYGAESNLWETYAIYTLNALGHEGQVSLLDGGF
    TVWDAAGGETVSEAPEAQEATYEPELDTGVVATREFVADNVDEDGAAIPILDMRSPEEYWGVDERGDLSRFGHVTGATNL
    NFVQSIDDEAGRLRSPEELETLWIDDAGISPDETAVAY
    CQTAIRASVGWFVLDQLGWEDVRNYEGSWADWGTLSEDNGYY
    YTSGEDTGTVVDTFA

    >gi|222480368|ref|YP_002566605.1| OsmC family protein [Halorubrum lacusprofundi ATCC 49239]
    MTAERQLSHGIDLETLDGFAAHAAENPQAVRLGLGASATYEGTAAHSLAKVDSYELGDETIARETREYTIPYGAWKEVLD
    AGGWVGGIDRLEPVEAALSALAA
    CINVGISINAAANGVDIDHLQTRVRTDFDPAVLFGLEELKEADSVFENLTAEIEIDG
    DNLDQDLIDEWARRAPVYTFVSLAQDVDMSVNTPAEMVSDD

    >gi|222480461|ref|YP_002566698.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halorubrum lacusprofundi ATCC 49239]
    MLEPGDPAPAIALSDQHGDAVTVDPAAARYTVVYFYPRADTPGCTTEACSFRDEWDAFEGADVAVVGISDDSVGDLEPFA
    EEYDLPFTLLSDPDGEVASAYDSYGEKQMFGNTFDGVFRNTYVIDADGTIALAYEGVSPENHAVEILDDIDVLDG

    >gi|222480495|ref|YP_002566732.1| heavy metal translocating P-type ATPase [Halorubrum lacusprofundi ATCC 49239]
    MRDGSNGSEETAGSETTGGAAGADGRRRELTVSLAVPEMDCPSCAGKVDNAIGRLDGVTNAALNPTAGTATVTYDPDVID
    EDDVVAAIEGAGYEVTGGRSGSDESGDDTEGGTDADTESGGVAVAPPAEVWTTARAKKTWLGAGLVTLGLLFEFILTAQN
    PEVASVLGVPFTLADALFLGAVAASGLPVIRGGYYSARNRSLDIDLLMGTAIIAATGIGYFVEAATLAVLFSIAELLEDY
    AMDRARDSLRELMELSPDEATVKRENAETTIPADDVAVGETVIVRPGEKVPLDGTVIEGESAVDESPITGESVPVDKVSG
    DEVFAGAINEEGYLEIEVTSTAGDSTLARVIEMVQGAQAKKTDTERFVDRFAGYYTPVVVVLAVLTAAIPPLVIAEPIAV
    EVAGYGITFAADWGTWFVRGLTLLVIACPCAFVISTPVSVVSGITSAAKNGVLIKGGNHLEAMGEVDAVALDKTGTLTKG
    KLTVTDLVPLGDADEATLLRRAAALERRSEHPIASAILDRADRTGVTDHPEPAAFESLTGKGIRAEIDGETYYAGKPALF
    EDLGFDLSRARAETDGGVVTEGDDADPPAGDIGPREFAEGTLAALEREGKTVVLVGTATQLTGAIAIADEVRRDSKRAVE
    RLRELGVKRVVMLTGDNEGTARAIAEQTGVDEYRAELLPEEKVEAVRALQAEYGDVAMVGDGINDAPALAAAEVGVAMGA
    AGTDTALETADIALMGDDVAKLPYLYALSHTANGVIRQNVWASLGVKALLALGVPLGLVSVAVAVVVGDMGMSLGVTGNA
    MRLSGIEPESFE

    >gi|222480616|ref|YP_002566853.1| OsmC family protein [Halorubrum lacusprofundi ATCC 49239]
    MAESDLQDDQEPLKREYDENPEAAQITLSATGEEQDDARSCSVDIGRAIYEAELHEGAGGPGGGACSGDLLLGALAACSQ
    LTAQAVAESFGVDADISVDASGDLDLRGTMGVDDEAPVGFEDLRLDVTVDGDIDEDTRSALRKYTEKYCVVYQTLADPPD
    VETNWTFD

    >gi|222480683|ref|YP_002566920.1| protein of unknown function DUF255 [Halorubrum lacusprofundi ATCC 49239]
    MTDETHVEWLDWGAEAFAEADERDCPVLLSLSATWCEGCHEMDAVTYAEPRIAANVNEGFVPIRVDVDRHPRVRERYNMG
    GFPTTAFLTPEGELLTGAGYLDVDGMRQVLESVRQMWADKGRSAGRVPRALDADLPPRGELTDAIESHLAGQIEAKYDEE
    HAGWGSDAKFPLPRTIEFALKRDRGRALRTLDAVRDHLADDVAGGFFRFAGTPDWGDVAYEKPIDTNAAVTRAFANAYLY
    TGDEAYLAPATDAVDFLTDGLWTGYGVGGSVGPGLGRAYYAASAADREELDPPRRDLTVFAGGNALAADALLAVAAYTDD
    ERAREYAERILDGLERDLIDADSGAVTHYRGSDEVGETDLLADAARVVSAYTRAAGVLGEGATVARAVADRAIDRLRVDG
    SFVDGPRSGAGLLDRPFRPLDGNVEMATALLDLAALTGEERYETVARETAESFAGATERLSVQVAEYGSLAGRLLRGTTV
    VAVGDEPGSDLHRAAWRVADHEKVVVPNAHREDAPAPRSVPVGSAVVLAGDVASQPAETPDELMTRVAETVE

    >gi|222480714|ref|YP_002566951.1| thioredoxin [Halorubrum lacusprofundi ATCC 49239]
    MSSTDAVPTEPIQLADPDEFDDYVADHDVVLVDFYADWCGPCQMMEPAVEAIANDTDAAVLKVDVDQHQALAGEYGVQGI
    PTLLVFVDGELAERMVGAQTEAALTDAVAEHTA

    >gi|222480751|ref|YP_002566988.1| Thioredoxin domain protein [Halorubrum lacusprofundi ATCC 49239]
    MKNNTESGASEPADDVSGSSTSTEVRRPVSLADEDALDAFVADADAAVIEFYTDGCGICASMEPVLGNVARELDLAVATV
    NPRDDPPLVERFDVRSVPLFVLFVDGEPVARRAEGFIPGDDLTAWITDHVA

    >gi|222480757|ref|YP_002566994.1| glutaredoxin [Halorubrum lacusprofundi ATCC 49239]
    MAIQLYALDGCPWCEKVSDALDEAGVAYETEWVDALHSDRSEVKRISGQRGVPVLIDEERGVTMSESANILEYVERSLV

    >gi|222480816|ref|YP_002567053.1| conserved hypothetical selenoprotein [Halorubrum lacusprofundi ATCC 49239]
    MTRIEVEYCVPCGMLNRARDVSEAILKQFGEEIDEVALVTGDDGVFVVRADGEVVFDKTEDEYDVDAIVRAVKPYVGAAA


    >gi|222480817|ref|YP_002567054.1| heavy metal translocating P-type ATPase [Halorubrum lacusprofundi ATCC 49239]
    MPPCTLCDLPTGDDPHTAPDVDGEFCCRGCLAVARSLGDAEGLDGLDEVEERRPDAEPDDDFEGETTFLHVDGMHCATCE
    SFLEMTAGEQAGVAAAEASYATDTIRVDYDPDAVGADELPERLSVAGYSASNRADPDAEGDDAVVRFLIGGGFFGMMAML
    WYVVFLYPTYFGYEPFLDLGGVSGLYLFTQVWVFASIVLFYTGYPILRGAYVSLRARQPNMDLLVSIAAVSSYAYSTLAM
    FLGRTDLYFDVTIAVILVVTAGNHYESLIKRRATGALSELTTVTDREVRTEAGETVATDAVAPGDRLLVRPSERVPFDGI
    VAEGAAAVDEALVTGESLPATKREGDAVRGGTVVTDAPIVVEVGEDAESTLDTLVRMLWEIQSSRSGIQRLVDKLATVFV
    PLVVAVAVLAAGATLAFGASPTEAALVGLTVLIVSCPCALGLATPLAVAAGIRDAARRGIVIVSDAVFEEAADIDTVVLD
    KTGTLTDGQMRLLGAETDGTDPATVRKRAAALERASVHPIAEAIVAGVRGEETEGDGIAARPAAATDGGTAIDGSAARDD
    GTGAATEPSPAAADVTVTDRGVSGRIDGDEVVVGHRSLFEGDAWAVSESLDAVGADAREAGRVPVYVGWDGAVRGVLVVG
    DEVREGWEAVVEDLAADGRRVVVLTGDSPAAARRFEEHPAIDETFAEVPPEAKAETVRRLTATERVAMVGDGSNDAPALA
    AADIGISVASGTDLAADAADAVLLEDRLSAIPELFAVTRGTNRRLKQNLGWAFVYNAVAIPMAVSGVLNPLFAAVAMGTS
    SLLVVSNSARAVYKGE

    >gi|222480830|ref|YP_002567067.1| beta-lactamase domain protein [Halorubrum lacusprofundi ATCC 49239]
    MDADEMDFPTPDSDVDSIEPESLKARIDDGESVTLLDARMSSDYEEWRIDGPNVESINVPYFQFLDEEIDDDVLARIPDD
    EHVTVL
    CAKGGASEYVAGALADRGYDVDHLEDGMNGWASIYETHEVTDYDGPGTLIQYQRPSSGCLGYLLYDGGEAAIVD
    PLRAFTDRYLADAEELGVELTYAFDTHVHADHISGLRNLADEGVEAMLPAAAADRGVTYADDVTLVEDGDEFTVGDATVE
    TVFTPGHTTGMTSYLLGDSLLATGDGLFIESVARPDLEEGDDGAPEAARMLYDSLQTRVLSLDDNVLVGGAHFSDAAEPA
    ADGTYTAPIGELRERMDALSADEDEFVETVLADMPPRPANYEDIIATNLGQNAVDDDEAFTLELGPNNCAASQDALTSDD


    >gi|222480831|ref|YP_002567068.1| protein of unknown function DUF395 YeeE/YedE [Halorubrum lacusprofundi ATCC 49239]
    MIDAIFADLLGPQTVDALFPNGISRYAIGGLLVGLGTVLIYLGTGITAGASTFLESTLSYVSGQSRFAQYLPSRDWRVVF
    TVGIIGGAAIYAVIYQGDPWSIAGSGWTTEVSAWRLFVGGILVGIGTRVGKG
    CTSGHGICGVGSVSRTSLVGVATFLLVA
    IVTANAVSALGVGL

    >gi|222480860|ref|YP_002567097.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halorubrum lacusprofundi ATCC 49239]
    MPPMIDTGVKAPDFIAPAVAGGTATELELFRLVDRHEAVVLCFAPATFVPTCTAAFAAIRDAGWHDRADLAVVALTGDSL
    YAGFAYADQFDLPFPIVSDFHGGIAESYDLLADSWEGHSDIPRRAVVVIAGDWTVRFAEATTDALDRPAPSPVQNATAAL
    HEIGVDVDRPRVNYDGPW

    >gi|222480900|ref|YP_002567137.1| iron-sulfur cluster assembly accessory protein [Halorubrum lacusprofundi ATCC 49239]
    MSTETVDTGSNPAIEVTADAATEALSLLEDEGLDTEVAGLRLFVQQGGCAGLSYGMRFDTEPEDDDLVVEHHGLRVFVDP
    ASRNYIGGSKLDYEHGLQAAGFEVENPNVVSECGCGESFRT

    >gi|222481052|ref|YP_002567289.1| glutaredoxin 2 [Halorubrum lacusprofundi ATCC 49239]
    MSETDASETVPVTVYTREDCSLCVAARETIEAVAEGLDVTIDLDMVDVDEDPELAEEYGERVPYVLVDGHPAFKYEIDER
    ELRLKLLAAS

    >gi|222481061|ref|YP_002567298.1| Rhodanese domain protein [Halorubrum lacusprofundi ATCC 49239]
    MGRILPDELAERLGTDDEPFLLDIRPESDHERDAIDASRNVPVYDDLRAGDESALRRRLDEIPDDREIVTVCKMGVVAKR
    ATRVLDEAGYDASTLAGGMSGWNGYERGSLGYRIRSLWWRLRG

    >gi|222481320|ref|YP_002567556.1| conserved hypothetical selenoprotein [Halorubrum lacusprofundi ATCC 49239]
    MTSVEVEYCDPCGFIDRATETQTQILESCGEPVDGVELVPGEDGVFEVRVDDTVIFDVDELEYDLTTIMEGVCGQLSACD
    CDPSELGGEDTDSTDCSPGCC

    >gi|222479773|ref|YP_002566010.1| OsmC family protein [Halorubrum lacusprofundi ATCC 49239]
    MADIETSTVSEEGYACTSQVGEFDLQIDATDETGPNPNAALVATYASCYLPAFRVGGSQRGEEELGKVQIDASAVLDDDD
    DLESIAFDVHVAADLDDETATDIAERAEGI
    CHVHSALRDDLHADVSVYPGAF