Halorhabdus utahensis DSM 12940 uid59189

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|257051238|ref|YP_003129071.1| UBA/THIF-type NAD/FAD binding protein [Halorhabdus utahensis DSM 12940]
    MSSPNLEQGQLDRYARQIVMDDVGPAGQAALLEGSVLVVGVGGLGSPVIQYLAAAGVGTLGLVDDDVVERSNLQRQVVHG
    TDDVGRAKVDSAEAFVAQLNPDVTVRCYETRFDEDEVPLGEYDVVIDATDSIEALYQLNDACVTAELPLVHGAVSAFEGQ
    VTSFDGGAPCYRCLFPEAPPAGTIPD
    CETAGVIGAVPSVIGSIQATEAIKHLLDIGTTLTGRLLRYDARSMSFTEIPFES
    REDCQTCGESPAGGPAATERTRGSTLE

    >gi|257051264|ref|YP_003129097.1| nitrite and sulphite reductase 4Fe-4S region [Halorhabdus utahensis DSM 12940]
    MSAIEFIPPAALGDRDAAIVDVREAAAYTDLGHVPGAANIPVDRFRDPTGIARGMLPDPTDLATWLGEAGISPTDPVIAY
    DDDCGVYAARFLATLAAFGHDGDLYLLDGDYSVYEREADVTVEQPDVEPVEYEPDDLDETLLADREDVEAAVDGEAIVVD
    TRTEPEFEQAHIPGAVQLDWKVFVDDETGRRRSVEAIGSTLAEHGLEPDRPVVLY
    CNTARRLSYVFAVLEDLGYGDVRFY
    EGSLEDWLRTETDDWDPAEIKRRVREHANQGPAAVKEALGEDAAAKLKLVGLYGQKQSGYFMFRTKIPGGVLTADAARAL
    GTVAEEYATLPEERDPKRSPFGDGYLDVTTRQDVQFHWIRMADVPEIWELLDPAGVSTFQTGGNSVRNVVSCPAAGVADD
    EVLDARPVAEAITEAFLADRRYANLPRKLKVSVNGCRGACAQPEINDLGFTPARKGDRVGFNLAAGGGLSDSPRVASDLD
    VFVERDQVVDVVRATADLFIEHGSYLDTAVNRLRFLVEEWGAEQFREELQRFAPFEFESAGEDLVTHHHPDHVGVHEQAD
    GDNYVGLSIPVGRIDGTDFRGMADLAESYGNGEIRLTTQQNLLLPDVADGDLDDLRAEPLLDEYSPDPGPFTRGVVTCTG
    REFCNYALVETKARAKRWAAELDERVDIDQDRVGLRFSGCTASCAQPQIDDIGLRGETRQTDDGVESAVDIAVGGKLNVD
    PQFATWIAPRVPIESAPDAIERLVAVFEREGRDCEQLHELCRLADDDRLAEVLHPAAIDPVEAAANGGRTDAD

    >gi|257051291|ref|YP_003129124.1| glutaredoxin-like protein [Halorhabdus utahensis DSM 12940]
    MSTETPTDAETVTEHVEGVIEENDVVLFMKGTPQRPQCGFSQRAVGLIRAHCEDFETVDVLDSLPEYRAALEAQSGWETI
    PQTYVDGEFVGGSDILAEHEQRGDLAETLAP

    >gi|257051346|ref|YP_003129179.1| protein of unknown function DUF395 YeeE/YedE [Halorhabdus utahensis DSM 12940]
    MFPDPIVLSLFEQFFPEGIARYAIGGLFVGLGTAVIYAATAIAPGASTFLESTLTFVSDRSRFQQYRATRDWRIVFTVGI
    VLGAAVYALIWQGEVWTTDVQPWRLLAGGILVGIGTRIGKG
    CTSGHGVCGIGSRSKTSLVGVITFLGVAIATAQVVMALG
    VSP

    >gi|257051355|ref|YP_003129188.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halorhabdus utahensis DSM 12940]
    MVTEGDSAPDFTAPLANGDVDSFTLSEHLDEAPIVLAFFPGAFTSVCSHEMTAFRDRIEEVSEAGATLYGISVDSPFALN
    EFRDKLELPFDLISDAEKEIVEAYDLAMDFDDLGVYDVAKRSVFVVNGDGEITYAWVSDDPGVEPDYDEVIEAATDAA

    >gi|257051371|ref|YP_003129204.1| DsbA-like thioredoxin [Halorhabdus utahensis DSM 12940]
    MTDHSTARSTRRAFIGGLAVTGTTGLAGCSGLFGGDSNPVANAPIPDNPGQYTYETMGSSDAPVSGAFVTNWKCPHCSTF
    STGFLGTIVEEYVEPGDVILEHRALAYSGQNPWMGEDAPRAAEAGLAVWRTDPASYWEYHEHVMANQGNPRDTWATTDRL
    VGFAEDVGVSNVEAVRTAIEDRTYEQTVRSTASALGRAGITSTPALVIEGEVFNALNKSAVKTALDEKTSNA

    >gi|257051413|ref|YP_003129246.1| Thioredoxin domain protein [Halorhabdus utahensis DSM 12940]
    MTVTLMDFHADWCGPCKTQEPILEDLEDDWPEVDFERIDVEEKQDIANEYQVRSLPTLIIENDDGVVERFIGVTQGGDIE
    DALEEAAA

    >gi|257051444|ref|YP_003129277.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halorhabdus utahensis DSM 12940]
    MADVLVVGGGPAGLSAALFTAKNDLETIVFDTDETWMHKAHLFNYLGIDSMDGSEFMDVSREQVESFGVQRNQGEEVTAV
    EDAGDGFTVTTDAGEYNADYVVLATGADRSLAAELG
    CATTEEGIVDVSVNMETSVEDAYATGAMVRAEEWQAIIAAGDGA
    AAALNILSKEKGEHYHDFDVPADAE

    >gi|257051546|ref|YP_003129379.1| Thioredoxin domain protein [Halorhabdus utahensis DSM 12940]
    MTAASQYDATDPPERPVALTDATDLDALIETYDTVLVEFYTDGCGVCASMEPILGIVAQDSDAVVGTINPRDDPPLVERF
    DVRSVPLLVVFRNGEPVERVADGFQPAEDVVALLESAT

    >gi|257051594|ref|YP_003129427.1| protein of unknown function DUF255 [Halorhabdus utahensis DSM 12940]
    MTDPTDRNRLAAEGSPYLQAHADNPVHWQPWDETALSTAEDEDKPIFLSIGYAACHWCHVMAEESFEDEATAAVLNENFV
    PIKVDREERPDVDRIYQTLAQLLGQQGGWPLSVWLTPDGRPFYVGTYFAPDSRGGRPGFADLLEDLKETWENDRDGIEQR
    ADQWADAISGELEGTPTPADPSDVRSDELLRAGADAAVRTADREQGGFGSGGPKFPQPGRLQLLLRADARFGSERSADGD
    GADPGEYRAVLTESLDAMVDGGLYDHVGGGFHRYATDRSWTVPHFEKMLYDNAEIPRALIEGYRVTGDERYARVAGETFE
    FLDRELGHPEGGFYSTLDARSEGEEGKFYVWTPEEVRAAVGDETDVSLVLDRYGITEDGNFEDGQTVLTIAASVDELAAQ
    SGLEVDDVQDRLDRAREQLFDARSERTRPPRDEKILAGWNGLAISALAEGSLALEDDILDRAVDALEFVRETLWDEDSGL
    LKRRFIDGDVRVEGYLEDYAFLARGALDCYQASGDPDQLAFALDLAEEIESRFFDEDAGTLYFTEEAGSDAGTDLLARPQ
    ELTDRSTPSSAGVAVDVLVTLDEFVPHDRFGVVAGAVLETHHSAIAADALQHASLVLGSDRDQHGSTELTIAADEIPAEW
    RERVGEVYLPARVLARRPATEAGLAEWLDQFGLEDAPPIFAGRAADGGPTIYACREFTCSQPLQDIEDALAWFDSGA

    >gi|257051595|ref|YP_003129428.1| Thioredoxin domain protein [Halorhabdus utahensis DSM 12940]
    MILETMEPNPVWNADAHADTVETLGDFADATFKIWGADWCGDCRSQLPDFAAALDAAEIPDDHVEHYPVDRDKQGDGVDA
    YGIEYIPTVVVERDGEELARFVEAEREPIAVHLATQLESAESTA

    >gi|257051750|ref|YP_003129583.1| redox-active disulfide protein 2 [Halorhabdus utahensis DSM 12940]
    MKIEVIGPGCARCKKTEQHVTQALDQLDAIDATVEKVEDQMEIIDRGVMHTPAVAVDGEIQTEGDIPDVDRLVEVLQSA

    >gi|257051763|ref|YP_003129596.1| protein of unknown function DUF395 YeeE/YedE [Halorhabdus utahensis DSM 12940]
    MSELVLALVAGVGFGVFFQKGRLCYASALSDFFLFRSSRVGGGILLATLLTTLSWSGAYLLGGKAGFWLPSWGFSGLIGG
    AIFGVGMILAGACLTSTLWRVASGSGQYALVLVGILVGFFLTGLAHPWLAEFYFTPLWLGTGGTAFAAPVPAPLVAVAFV
    GVVVLAYAGVAGSTTRRFDGPIDEDEGRINGLRESVRVGLAGLVAGTRQYVGARTSGIDVARALRRPWDPRTCGIGIALT
    ATLWIGVSSVWTVSGPLEDWVAFGFGAISTDLLETVPGFAAAYSGSISPGMGVIAGFLLGAFLAALAGGDFEFTPPSRSA
    GVTPVAGGILMGVGATLAPG
    CNVTNLYTGLASLSIHGIVAGTGIVLGAYASTRLLFRARG

    >gi|257051903|ref|YP_003129736.1| thioredoxin [Halorhabdus utahensis DSM 12940]
    MTGGDDIEAIKQRRKEQLMQQDQSEQTSAPNEPIHVESTEQFNEVVGTHDVVLADFYADWCGPCKMLEPIVEELAADTDA
    AVAKVDVDAHQQLASQYQVRGVPTVIVFAGGEVAEQVVGVRDQSHYRSLLERHGSD

    >gi|257051920|ref|YP_003129753.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halorhabdus utahensis DSM 12940]
    MTESNEPSEYDVVVVGGGPAGQSAALYATRLGHRTAIVDVGGGRAAMIQDVHNLIGVPEDDSGMELLQTGREQLEGYGCD
    FYRDRVASCSREGDDIRLVGNSNEYSATAVVLATGFNDVRPEPPLPRTGRGLHY
    CLHCDAHMFVDEPVYVMGHGESAVHV
    AGIMLNFTDEVDLLTRGDDPEWSEGTAETIEGHPIDVIHEDIAGVQNGEDGWLKTLEFADGEIREYKGGFAMYGAEYNNG
    LARELGCAINDDGTVEVDDHGRTSADNVYAVGDLTPGHNQLPIALGAGAKAGIDIHFSLRDFPRDPDVLDAQGPVRDEEV
    PGIPDQLLEQAVDFHTYGE

    >gi|257051925|ref|YP_003129758.1| dihydrolipoamide dehydrogenase [Halorhabdus utahensis DSM 12940]
    MAHYDVVVIGGGTGNNVAAAAADAGLDTALIEKGSLGGTCLNRGCNPSKMLIQAANAAQQVQDADRFFLDASLHDVDFSA
    IVSDMDETLSGLAEGMEADYRATDDLTLYDDEAVFVDERTVLVDDEHISGEKVVVAAGSRPFIPPIEGLGTVEYLTSREA
    LYLDEQPESLVIIGGGYIAVELGYVFETLGTDVTIIESGETLLGREDPEVSEAFTEIARKRHDVHTGYRATAVEPLGEGV
    RVFAEGGDGGDDVIECSGEDVLVAAGRRPNSDSLDVASAGIETDNRGFIVTDERLQTSAENVWAQGDIAGNAMFKHAGDY
    ETRVVIDNVVHDAGREMDLSALPHAVFTEPQIAGVGATEAELKTADHPYVVGRQALPDTPMGRAKKLEEGFVKVLATPDG
    EILGCHMLGEEVSTMIHEVLVAMRAGSGQLSDITDTIHAHPTLNKAVEYAFRDALDA

    >gi|257051968|ref|YP_003129801.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halorhabdus utahensis DSM 12940]
    MSTHVAVVGAYGSAGAAVAGDLADDPEIELTLIDDGDPGGGLCILRGCMPSKEVLSAAEHRFAARKDERLVGDVPDVDVE
    AVVERKDQHTSGFAQHRRDAIAELAEQDNVEFIHDTARFVDDRVLEVDGRRIEPDYVVIATGSNVAIPPIPGIEDVPVGT
    SADVLDRTEFGDSAIALGLGYIGLELVPYLTEAADMDLTVVEALPDVLEEADEPFGEELLDYYKEHFDVDVLLDAEGQHV
    EQTADGGVRMTVDVGDETRTIEADELFAFTGREPALDRLGIENTSLSPGEGWVSDTMQAAGDDRVFVVGDVNGREPILHV
    AKEEGFTAAENIRHLRDGESLDEYENVHHHVIFSGLGVLPYARVGHSVESAEAAGLDFVTATRDASSDGVFKTKDVADGL
    ARLVVGTDGTVLGYQGLHYHADVMAKTMQLAVEMELDVREIPDRAYHPTTPEVLDGLIGDTAAKLD

    >gi|257052328|ref|YP_003130161.1| Thioredoxin-disulfide reductase [Halorhabdus utahensis DSM 12940]
    MQNTAYSSPEASRLYATVLYYQYTMADVAIIGGGPAGLAAAVYTARADQETLVFDKGGGTTRDVDWMENVYGFPEGASGP
    ELVDVGREQATKFGAAIVEEEVVQVGEDGDGYHIETEVDEYEVKGVILATGASYETPAIPHVDDYEGGGVSY
    CVECDAFF
    YRDKPVAVVGAGNYAAKEAMMLLDYTDDVRVLTNGNAIDMDDALLDQLEGEGIPVIEEPVDHIVGDEVVEGVELDAGEQL
    DVEGVFIALGAAGGTDIADMLGIPRDGSYLDVDEDQYTGVDRVYAAGDLTGGQRQVNVSVGEGTTAAINLLEDFRGGEYI
    DYKKIEA

    >gi|257052361|ref|YP_003130194.1| hypothetical protein Huta_1285 [Halorhabdus utahensis DSM 12940]
    MQPPSRRALLAAAGTAAVSLAGCASDGTDSPADGDTDQTASTTEADTGEPTADPRTTAAETMAAKTTAGSNDTEPVWYTE
    QLTDARTGERFSIAELNADGPVLLETFAIW
    CSNCQRQQVELQTFHEQAPDDVTTVALNVDPNEDRSAVADHAEENDFDWR
    YAVSPPAITQSLIGEFGRSITVPPQVPMVRICPGGETTRLPDGHKSTDDLLSALDSCE

    >gi|257052399|ref|YP_003130232.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halorhabdus utahensis DSM 12940]
    MLSPGEQPPAFTLPAVVEGDIETVSLDEYLGDRIVILAFYPGDFNPACGEESDLDELDLFTMQPDVAVIGIAPDTVFSHR
    KFAEEYDLAIPLAADTRGEVASAYGVDFEDEHGQHLAERAVFVIDLDGVVQYTWSTQDLRKVPPTEPIQRAVGDIGGDRA
    AVSRYRVAHAHYIEGRRAFTSAMGEFEDHDWMVSRSDFERAREEFTTATDQFASAGRFVDDDRLSEHFERARRKANALWQ
    AADWLAEAADAFSSGDGEEGNAYRSDAESPLETARDLAEPLDPDDITVEDDEITIDPDALEDDDTVSAMEAIRSGMDEGA
    AAGGVDLELEEVTIETDDDDELPDHDDPDTETARRMREYAGAGMEIDDPGGAEDDQIADALAEADESIEPADATDEGEAK
    TDAGEQPPDGSRGQNGPAETEGSDRPAQREAETGHENEATGETETSDTAADAEADVTDEEIEEIAEELQSQSDETAADDE
    RSE

    >gi|257052477|ref|YP_003130310.1| Rhodanese domain protein [Halorhabdus utahensis DSM 12940]
    MDGECSAADLRSLLDGEQDVRIVDVRPPAAFERGHIPGSENVPLATLTNEVDRFDGADRVVTVCAHGQASIQAARLVSAY
    EGIDGPVESLSCGVDGWDGNLEMGDGR

    >gi|257052501|ref|YP_003130334.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halorhabdus utahensis DSM 12940]
    MSERFLVIGGDAAGMSAASKAKREDPDREVVVLERSEWVSYGACGLPYYVKGEIDSLDDLIAIPADRFREERNIDLRTGH
    EAIGIDRSRKEVTVETDAGEEYGIGYDDMLIATGAGALEPPIDGLDAENVFTLQEMNAGRTLKEAIETGAYDRFGIIGGG
    YIGIEMAEAFRGRSIDVTLFEMRDHVLPPFGASAAETVAGELEDNGVDVRTSTRVQALEGKNAVERIVTDDGAVEVDAVL
    VAAGVDPNVELAEQAGIDLGPTGAIATDAYGRTSDDAVYAAGDCAEMTHAVTDEPAHVPLALTANRAGRAVGATVGGDPT
    PVGDIAGTAVLKAFDLAVARTGMLDEEELRDAGFDPVSVTITSASRAHYYPGGSEIEVTLVGDAESGRVLGASIVGHEGV
    AKRIDPIATAIQSDLTVEDVEYLDLSYAPPFGPTWDPILTAAKVLNGKLD

    >gi|257052541|ref|YP_003130374.1| heavy metal translocating P-type ATPase [Halorhabdus utahensis DSM 12940]
    MSDEPGRDAEEGAQTGERASDGRKIQLAVPEMDCPSCAKKVDGSLERVDGIREVSLSPTKGTASVTYDPDRTTERDVIAA
    IEGAGYEVPGSRDGDDETGSGDPEIAPPTEIWTSSRAIKTWVGAVFLTLGLAIEFLLTGGNVEVATVLDYPIAVADALFL
    VAIIVSGAPVVRSGIHSARNRSLDIDLLMGVAILAATAIGYVVEAATLAVLFSIAELLEDYAMDRARDSLRELMELSPDE
    ATVRREAAATDGSEASERASGETASRGGEEVTVPAEDVEIGETVLVRPGEKIPLDGTVIEGESAVDESPITGESMPVEKG
    PGEEVFAGSITAEGYLEVEVTSTSGDSTLARIIEMVQSAEENRTESEQFVDRFAGYYTPVVVVLAILTAAVPPLLITGSA
    TLALAGFELVLPGGWRPWFVRGLTLLVIACPCAFVISTPVSVVSGITSAAKNGVLIKGGNHLEAMGEVDAIALDKTGTLT
    KGELAVTDVVPVGEREEGDVLRRAAALERRSEHPIAAAIRERADRAEIDPPDPDDFESLTGKGVRAEVGGETAYAGTPAL
    FDELGLDLGALGFETGGDARTDGGSLEGRAASGETVAERIAALEREGKTIVVVGTASEVWGVVAVADEVRPTARRAVERL
    HDLGVEHVIMLTGDNEGTARAIAAEAGVDDYRAELLPEDKVSAVETLQAEYGDVAMVGDGINDAPALATADVAVAMGAAG
    TDTALETADIALLGDDIGKLPYLYSLSNRANGVIRQNIWASLGVKALLAVGVPLGYVSVAVAVVVGDMGMSLGVTGNAMR
    LSRIAPDNDSHGTTAPSRQESAAER

    >gi|257052824|ref|YP_003130657.1| Heavy metal transport/detoxification protein [Halorhabdus utahensis DSM 12940]
    MTQTITVEGMSCAHCEETVEEALESVGGVTDATADRETESATVEGTAEADALVSAVEDAGYDAAP

    >gi|257052826|ref|YP_003130659.1| heavy metal translocating P-type ATPase [Halorhabdus utahensis DSM 12940]
    MSCANCSGTIQDTLESLDGVIEASANFATDEGSVEYDPEVVTLGEIYEAVENAGYGAVSETVTVAISDMSCANCAEANAT
    ALEDTPGVIGAEVNYATDEAQVTYNPAEASRADLYDAIEAAGYSPVREDDDDAGDAGADARDAARDEEIRKQLRLTLFGA
    LLSAPMLVFMADKLVLGGGIVAGVESLVGIRLGWVEFALATPVQALLGWPFYKNSYNALVNNRRANMDVLIALGSSTAYL
    YSVAVLSGLIAGEVYFDTAALILVFITLGNYLEARSKGQAGEALRKLLEMEAETATLIGPDGTEREVPLEDVQTGDLMKV
    RPGEQIPTDGVVVDGQSAVDESMVTGESVPVEKREGDEVVGSTINENGLLTVKATKVGADTALQQIVQTVKEAQSRQPEI
    QNLADRISAYFVPAVIANAVFWGVVWFAFPEVLAGFVDALPLWGLVAGGPEIVGGAVSIFEFAVIVFASAVLIACPCALG
    LATPAATMVGTTIGAQHGVLFKGGDILERARDVDTVVFDKTGTLTEGEMELTDVVALDGEETAADGGAVAERQRHTEDDV
    LRLAAAAESGSEHPLARAIVDGAEERGLEIPEPDDFENVPGHGIRATIDGSEVLVGNRKLLEDEGIDPAPAEETMERLER
    EGKTAMLVAIDGELAGVVADADTVKEGAKEAVAALRERGVEVMMITGDNERTARAVAEQVGIDPDNVRAEVLPEDKSDAV
    EQIQSDGRKAMMVGDGVNDAPALAVAHVGTAIGSGTDVAIEAADVTLMRSDPQDVVKAIRISDATLQKIKQNLLWALGYN
    TAMIPLASLGLLQPVLAAAAMAFSSVSVLTNSLLFRRYTPEEDYRIFGRLR

    >gi|257052859|ref|YP_003130692.1| glutaredoxin [Halorhabdus utahensis DSM 12940]
    MPNLELYELDGCPFCAKVTKKLDDLDLEYESHMVPSAKSARDEVEAVSGQRGVPVLVDNDNGVEGMPESDDIVDYLEETY
    GSGE

    >gi|257052876|ref|YP_003130709.1| dihydrolipoamide dehydrogenase [Halorhabdus utahensis DSM 12940]
    MSTAFAVPDLGDGATEGRLVALEVAAGETVAEGTLLAEVETDKSIVEVTAPETMAIEACDAAEGEDVEVGETLFTYEAAD
    PDDPSESGDGEGGEPAEPPEPTEDGPSEPDDDSADAVGGASQLTGGASERTVRPVGEGTPADVPSPGSVEGVPEQTDVLI
    IGAGPGGYVAAIRAGQLGLDVTLVEDDAVGGT
    CLNYGCIPSKALIHGADIAYEAANAEHLGVSADPTVDIDQLTGWKDDV
    VDQLTGGVEQLCHAQGVTVVDGVAEFVNNRRATITTDDGETAIDFGNAIVATGSRPIEIPDFPFDSEYVLDSRDALALDE
    RPDSLVVIGAGYIGMELSTVFEKLGTDVTVVEMFDDVLSGYDDDISRLVRERAAEFGIDFRFGEMAASWEETDDGIVVHT
    EDEDGDRHSLEAEKVFVVGGREPVTDTANLQAAGIELDDDGFVKTDAQGRTTCERIFAIGDVVGEPMLAHKASREGEVAA
    EAIAGEPSVLDYQAMPAVVFTDPEVATVGMSENDARDDGYYPVVGRMPLASNGRALTLGDTEGFVRIVADRRTELILGAQ
    IVGPNASELIAEVALAIEMDARLSDIAETVHTHPTLSEAVMEAAANARGEAIHTAD

    >gi|257052877|ref|YP_003130710.1| alkylhydroperoxidase like protein, AhpD family [Halorhabdus utahensis DSM 12940]
    MPLQSNIYVMSKSDELAEMKQSLHQLVGEAENLEGFAGYVEATESPGALDTKAKELMSLAVGCVARCEHCVLWHMDGALE
    AGATREEVIETLEVAVLMGGGPAMTYAIEAYEILEELEAEKDA

    >gi|257052880|ref|YP_003130713.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halorhabdus utahensis DSM 12940]
    MESETDDASGIPLIGDEFPHLAVETTHGEIDLPDDYAGEWVVLFSHPGDFTPVCTTEFVAFEDRREEFEQRDANLIGLSV
    DRVHSHLKWVDWIEEEIGVEIGFPIIADESGRVGEQLGMIQSGAGTSTVRAVFVVDPDGVVRQVLYYPEEIGRNIDEILR
    SLDALQKSDDEGVATPANWPENDRFDDRVLLPPPGSRGAVEQRESEADDEGYEQYDWWFTLSEQ

    >gi|257053142|ref|YP_003130975.1| methionine sulfoxide reductase A [Halorhabdus utahensis DSM 12940]
    MESATFGGGCFWCTEAAMKELDGVASVTSGYAGGHAEDPSYRAVCSGDTGHAEVVQVEYDPDVITYDELLEVFFATHDPT
    QLNRQGPDVGTQYRSIVLYHDEAQRETAAAYIDALDAEYDDEVVTELTELETFYRAEEKHQDYFEKNPTDAYCQMHAAPK
    VEKIRERFEELVAES

    >gi|257053143|ref|YP_003130976.1| Thioredoxin-disulfide reductase [Halorhabdus utahensis DSM 12940]
    MTDEIEHRRLIIAGSGTAGLTAAVYAGRANNDPLVLEGDEPGGQLTLTTDVANFPGFPEGINGTELINRMKEQAKRFGAD
    VETGFVESIDDSSRPFRVELADGAVYTCDAFIAASGASARTLGIPGEGDLMGYGVST
    CATCDGAFFRDEDMLVIGGGDAA
    MEEASFLTKFADTVYIAHRREAFRAEDYWVDRIMEHVDAGDVEIMRNTEATEIHGSREDGIEGVSLIRHPDGHPKEKLDS
    EQAEEVEHFEHDVGAVFLAIGHTPNTGYLEDTDVELDETGYIRTVGGHGGGQTKTDVPGIFGAGDVVDYHYQQAVTAAGM
    GSQAALDADDYLEEQAEAEATETSVAETDD

    >gi|257053162|ref|YP_003130995.1| Rhodanese domain protein [Halorhabdus utahensis DSM 12940]
    MGTVYMIGCIMTEYANDVLVSAEWVEDNLSEFESDDPAHRLVEVDVDTEAYDEAHAPGAIGFNWESQLQDQTTRDILSKA
    DFEDLLGSHGISEDSTVVLYGDNSNWFAAYTYWQFKYYGHDDVKLLDGGREYWVENDYPTTSEEPDFSAVEYDASGPRES
    IRAYREDVENAIERGLPLVDVRSPEEFRGDILAPPGLQETAQRGGHVPGAQNISWAAVTNDDGTFKDFDELAELYSDYGI
    DGDSTTVAY
    CRIGERSSVAWFALHELLGYDDAINYDGSWTEWGNLVGAPIEKGEADD

    >gi|257053163|ref|YP_003130996.1| Rhodanese domain protein [Halorhabdus utahensis DSM 12940]
    MTDIVTTAWVADRLGDVHLVDVRDAWEYEGIGHLPGAVSISFDSFRASEGDEGMLPGEDVFADLLSDAGIALEDDIVAYD
    DTHGVFAARFLVTAELYGHDPDRLHLLDGDFSAWQRDHPTTDEVPDVTPTAYEVDRPAESTLVGREAVAAAIDTDAVIVD
    TRERWEYEEGHIPGAVQVDWRDLVDDETRGIKPREEIEAILEPKGITPESRIVLY
    CNTARRISHTYVVLKHLGYRDLAFY
    EGSLTEWEAAGEPIETAE

    >gi|257053174|ref|YP_003131007.1| glutaredoxin [Halorhabdus utahensis DSM 12940]
    MSESTTDASEEGDATITLYRLQACPFCERVARTLSEYDLDYQSRFVEPLHSERNAVKRVSGQRAVPVIIDERTGVTMSES
    ERIVQYLDRTYGEA

    >gi|257053177|ref|YP_003131010.1| glutaredoxin-like domain protein [Halorhabdus utahensis DSM 12940]
    MSILDDDDRAEVSELLEDMDEPIDIHVFTQDDCEYCEETVALVEDVANLSDAVEMGVHDMDDPLASDLGADRYEGGPVTV
    ITREDIDGVRYFGIPSGQEFSSFLQDMITVSTGEPDIDESVLEEIAEIDDPVEITVFVTPT
    CPHCPKAVQTAHNFAVANE
    NITANSVESQEFMELSQEFGVRGVPQINVNGTDGEFTGALPPQQFLQEVKGAL

    >gi|257053704|ref|YP_003131537.1| methionine-R-sulfoxide reductase [Halorhabdus utahensis DSM 12940]
    MGDPKSDSVPASETEWREVLTEEEYHILRERGTEPKFSGEYLDVDDDGVFRCAGCGAALFDTDSQFESGHGWPSFTDVVE
    DGNVETELDTRHGRERTEVLCAECGGHLGHVFDDGPEPTGKRY
    CINSAALDFETDDE

    >gi|257053916|ref|YP_003131749.1| Redoxin domain protein [Halorhabdus utahensis DSM 12940]
    MTALDSEREAIERGEVAPDFELPGTDGETHALADFTDHEAVLVVFTCNHCPYAVAKFDPLNELAAEYDDLAVVGINANDS
    DEYPDDSFEKMVELVEDGTIAYDAYLRDESQDIARAYGAVCTPDPFLLENDGGAFRLAYHGRIDDAMSPDEEPETFEMRN
    VVEDLLAGRELTDEFRPSRGCNIKWTDGSVRPE

    >gi|257054024|ref|YP_003131857.1| Redoxin domain protein [Halorhabdus utahensis DSM 12940]
    MRRRELLAGVGGAAVVGAGGYLALTAGEERIDPTVIDLFDTSTTAGAELRVPVNGEVTVVDLFATWCQPCKPALDALRTV
    QAETTDIAFVSVTNEVLGGELSRDDVLAWWDAYGGAWPVGHDPEGGLLASLGASTLPYTAVVDPSGRVVWAETGVPDPER
    VSQAIADARP