Halomicrobium mukohataei DSM 12286 uid59107

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|257372919|ref|YP_003175693.1| heavy metal translocating P-type ATPase [Halomicrobium mukohataei DSM 12286]
    MTSKSETAGEGGQDPGETTVRVTVPEMDCPSCAQKVDKSLQRVDGVRETTLQPTTGTAIMTIDTGETSEAEVRGAIESAG
    YEVSGEPGDSSGEGIEVAPPAEIWRSSRAVKTWIGAAFVTLGLLFEFVLGGQNVALGSVFELSLHLADGLFLVAIVVSGY
    PVVRGGYYSAKNRSLDIDLLMGTAIIAATGIGYFVEAATLAVLFSIAELLEDYAMDRARDSLRELMELSPDEATVRRNGD
    EETVPAEDVAVGETVVVRPGEKIPLDGTIVEGTSAVDESPITGESVPVDKNVGDEVYAGSINAEGYFEFEATSSASESTL
    SQIIEMVQGAQEKKTEKEQFVDRFAGYYTPTVVVLAILTAALPPLFIGGGATVSVAGIGHTFVGSWQTWFVRGLTLLVIA
    CPCAFVISTPVSVVSGITSAAKNGVLIKGGNHLEAMGGVDAVALDKTGTLTKGELAVTDVVPLGEASETELLRYAAALEQ
    RSEHPIAEAIRERARESAVGELPVVEAFESITGKGLRAESDGETYYAGKPALFEELGFDLSHAHARPDGGTVVEATDDEC
    DRDDCADLEAGAISQFEAEGKTVVLVGTATELLGVVAIADEVRPAASRAIERLHELGVEHVVMLTGDNEGTARAIADRVG
    VDEYRAELLPDEKVDAVESLQASHGDVAMVGDGINDAPALATADVAVAMGAAGTDTALETADIALMGDDIGKLPYLYALS
    NEANSVIRQNIWASLGVKAVLALGVPLGLVSVALAVVVGDMGMSLGVTGNAMRLSRVTPDRFFEE

    >gi|257372961|ref|YP_003175735.1| glutaredoxin 2 [Halomicrobium mukohataei DSM 12286]
    MADTTVTVYTREECHLCDDALRTIRTVAESVARSVDIEVVDVDEASLREEYGDRVPYVLVDDRPAFKFRVDERELRQKLV
    A

    >gi|257373045|ref|YP_003175819.1| heavy metal translocating P-type ATPase [Halomicrobium mukohataei DSM 12286]
    MGECTLCGLPTPDPPHTAPDVDGAFCCQGCLTVARTLDDAPADADPQTAVDTGPDVDSVDGDRAYFDVDGMHCATCETFL
    EATATDAPGVRAAEASYTAGMVRVVFDPATAEPDAIADRISGHGYDATQEGAASADDAQETVGRLMVGGFFGMMVMAWYV
    LFLYPVYTGVAPSSLLVDLDGPAGGFLFANVWVMATVVVAYTGYPLFRGAVVSLRVGHPNMDLLVAIAAATAYVYSTIAM
    ALGQTDLYFDVAVVVVLAVTVGDYYQERVRRRAMGRLATVSDERADAARRRTADGIESVSRSAVDGGDELVVKGGEPVPV
    DGTVVEGTAAVDESLVTGESLPVSKATGDAVLGGTTVTDGGVVVRADEDPTSTVDRLAETLWEVQSATPGAQRLVDRIAA
    VFVPLVFVLAVGTLVVHLLAGTGATAALLTGLTVLVVSCPCALGLATPMAVAAGIRDALDAGIVITDDTALETAPAVETV
    ALDKTGTLTTGSMTVRTVVGHDESLAYASAVEQFATHPVAEAISEAGTPPDEPVTAFETIPGRGVQATVGDRTVLVGDES
    LFAARDWTVPSGVAATYDGAGDDAIASYVGWDGRVRGAVVVGDEVREGWQSVLDRLAADRRVVVITGDDRAAAEQFASHR
    SVDEVFAGVPPEAKAAVVDRLGVDGTVAMVGDGSNDAPALGAADLGITVESGTRLAFDAADVVVTDDSLAALPEVFATTE
    GTRRRIRENLGWAFLYNGIALPLAVVGVLNPLFAAVAMATSSLLVVLNSTRPVGSEAGS

    >gi|257373055|ref|YP_003175829.1| beta-lactamase domain protein [Halomicrobium mukohataei DSM 12286]
    MNAEDFPTPDADVASVAPETLKDRIDDGESVTLLDARMSTEYEKWHVDGENVTSINVPYFEFLDDEIDESVLDRIPDDRE
    VTVL
    CAKGGASEYVAGTLVEQGYDVDHLEDGMNGWASIYEAVEVQRYDGAGTLLQYQRPSTGCLGYLLYDDGEAAVIDPL
    RAFTDRYLADAAELRSASPASQARQDEDFGVDLQYALDTHVHADHISGVRALDDEGVEGVIPEAAVDRGVTYAADGSSAS
    PASQARQDADALTTAADGDTFQVGDATIEAVHTPGHTTGMTSYLIDDSLLATGDGLFIESVARPDLEEGDDGAPDAARTL
    YESLQERVLTLPDDTLIGGAHFSDAAEPADDGTYTAPIGELVAEMDALTMDEEAFVDLILSDMPPRPANYEEIIATNLGQ
    NAVDDEKAFTLELGPNNCAASQGSLADD

    >gi|257373056|ref|YP_003175830.1| protein of unknown function DUF395 YeeE/YedE [Halomicrobium mukohataei DSM 12286]
    MTDPLALQVTAELFPNGIGRYAVGGLLVGLGAVVIYVGTGIPAGASTFLESTLSYVSDQSRFQQYVGSRDWRVVFTLGIV
    LGGLAFAATVQSGLVSTALYQTGTTGQLYEVGGVTLWTTNVQPWRLFVGGVLVGIGTRVGKG
    CTSGHGVCGVGSASKTSL
    VGVATFLTVAIGTAQVVAALGVSP

    >gi|257373060|ref|YP_003175834.1| thioredoxin [Halomicrobium mukohataei DSM 12286]
    MTTDIEAEAGAGTPTEPVHVDGQSELDGAVADYEVVLADFYADWCGPCQMLEPVVETLAAETDAAVAKVDVDENQQLATA
    YGVRGVPTLVLFADGEQVEEIVGVQGEDELRSLVEQYTA

    >gi|257386261|ref|YP_003176034.1| peptide methionine sulfoxide reductase [Halomicrobium mukohataei DSM 12286]
    MSEPQTATVAGGCFWCTEAVFKQIEGVESITSGYAGGHVADPSYDAVCSGETGHAECVQVEYDPDVIDYGDVLTVFFATH
    DPTTKNRQGPDVGSQYRSAVFYHDEAQRETVEAMIDDLGDQYSDPIVTEVEPLETFYPAEQYHQDYYERNPDQGYCAVNI
    DPKLEKLNEQFRELLA

    >gi|257386349|ref|YP_003176122.1| periplasmic binding protein [Halomicrobium mukohataei DSM 12286]
    MRVVTLLPSATEIVYALGVEPVGVSHECDYPPAASEQPSVNRSRVDPTAASGEINEQVAAAEEEGVYAIERETLASLDPD
    LIVTQGVCDV
    CAVDHVVVEDAVAELGLDAEVLTLDVHSLDDLFESIQRIGDVLGRGERASELVGDLRSRVAEVETTAGRA
    ESTPSVAVLDWTEPVMVAGHWVPEMVASAGGEYGLESAGAHSRPREWDEIRAYDPERLIVSPCGFDLAQIRENLTDLTER
    PGWAELSAVRNGHVTLVDGHHYVNRSGPRLVDTLEFLGWAIHPDPFDRPPRDAVSR

    >gi|257386350|ref|YP_003176123.1| UBA/THIF-type NAD/FAD binding protein [Halomicrobium mukohataei DSM 12286]
    MVDLDPEQLDRYSRHVIMDDVGPSGQAALLDASVLVVGAGGLGSPVLQYLAAAGIGRLGIVDDDVVERSNLQRQVLHTDD
    DVGRPKVDSASEFVADRNPDVTVDAYETRLTRDNAEEVIADYDLVVDASDNFGTRYLVNDACTLAGTPVSHGAIYRFEGQ
    VTTFSGEGPCYRCLFPSAPPEGAVPD
    CATAGVLGVLPGTIGCFQATEVVKWFLDEGESLDGRLLVYDASEMSVDEVPIAP
    NPDCPVCGSDPALSSVTEAEYDGRCSLSESVSD

    >gi|257386383|ref|YP_003176156.1| Thioredoxin domain protein [Halomicrobium mukohataei DSM 12286]
    MTVTLKDFYADWCGPCKTQDPILEELEADWGDVSFEKINVDEEQDVANEYQVRSLPTLIVENDDGIVERFVGVTQREDLE
    DALQQASA

    >gi|257386430|ref|YP_003176203.1| Thioredoxin domain protein [Halomicrobium mukohataei DSM 12286]
    MSTETQPRPHLLDSKPALDDLIASEERLLVEFHTKGCSLCEAMAPVLDAVAKGTDATVATMNPRDDPVLVDEYDVRSVPK
    LLLFVDGELVETLEDGFVPVDDVRAFVTEAE

    >gi|257386432|ref|YP_003176205.1| DSBA oxidoreductase [Halomicrobium mukohataei DSM 12286]
    MTDTDAADRPESPTTDEIAVYSDYVCPFCYLGRESLRQFQADRDEQLRIDWRPFDLRHNKRNPDGSIDHSVDDGKDDDYY
    EQAKESVRRLQAEYGVEMSLDLASEVDSLSAQIASYHVKTTADYETWLDFDTSIFTALWQEERDIGDPDVLADLAERAGL
    DGDEVRAALDDETLREEVTTRFTEAQREGITGVPTFVYDGYAARGAVPPEQLERLVDGT

    >gi|257386454|ref|YP_003176227.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halomicrobium mukohataei DSM 12286]
    MTDPFVAIGGDAAGLSAASKCKREQPERDVIVFEKGSWVSYSHCGMPYFVKGEVDRLDDLLSLSPAEIRERGIDLRRGHE
    VVAIDSDARVLTVETSAGDRLEQPYGDLLIGTGARAVTTPIEGSDLAGVHTMHGLDSAAAVRAHLLDPAVDAVADVGGEE
    FVDRELVERHAAFEPPETVAIVGGGYVGVEMAEAFSAHGLDVHLFQRGEHVLPPFGEAVAEVVEGELAAEGVTLHLGEEV
    QRLDGDDGRVERLVCAGGASLAVDLALVGIGIRPNTDLLADTPIETGVADAVAVDDYGRTNVDGVYAAGDCATMRHAVTG
    ERDWVPLGLTANRAGRAIGATVAGDPTPVGDIAGTAVVKAFEQECGRTGLVDHEAASDAGFDPVSETITAGSRSGYYPGG
    AETTVTLIADRDSGRLLGGTIVGTDRAAIRIDIVAMALEQDATVGELERSDLAYAPPFSPVWDPVLTAAKVLGSSVQERY


    >gi|257386671|ref|YP_003176444.1| Rhodanese domain protein [Halomicrobium mukohataei DSM 12286]
    MDGEIGHEELETILENGADARVVDIRSPGAYERGHIPGSENVPLQQLVDDIEQFDGAERVVTVCPHGKSSVQAARLIASY
    EGFSGRAESFGPGLASWDGPIESGRGEGEADEDAGAPADEGPDAPF

    >gi|257386813|ref|YP_003176586.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halomicrobium mukohataei DSM 12286]
    MISEGDEAPRFELPAVVDGEHRRVALDEYLGEDVVILAFYPGDFNPACDEESDLDELDLFTMQKDVSVLGISADTLYSHA
    AFAEAYDLHVPLLSDTRREVAREYGVTFEDAVGQALIERAVFVVDHDGVVRYAWSTQSPLALPDVDAIKDTIGDTGGDDT
    AFARYRVGHAHYTEGRRAFTSAMGSYQDSEWMLAQSDFGRAQEAFEEAADHFDSAVRFVDDADLSTYYERAEEKATALWQ
    AAEWLSESASEYSSGAGAAGQRLRDDAERPLETARDIGEPIDPDDWPPDLDADDAQSILPQDDDAEVELAIDIDEAATGG
    PEADAPSLDDTPAGERSSDEAGGEEEIDDDELQEIEAELTANQPDDPTGGDLEETPTSMVDAPPDADDGDAGGDDDPAEL
    QADLETGQSAGEGSRADGPDEERADSTPDTPSLDPDEADVPPPGSGSLEPGGGSGDGAALDDDDGGASLDDGPDQRDHLD
    ETDELDEPDGASDEDMAAIPTEEELAEDDADDDGERY

    >gi|257386912|ref|YP_003176685.1| glutaredoxin [Halomicrobium mukohataei DSM 12286]
    MTNLELYELEGCPYCAKVIDKLDELDLDYQSHMVPRSHDERTEVEEVSGQTGVPVLVDPDNGVEGMAESDDIVEYLDETY
    GTVA

    >gi|257386950|ref|YP_003176723.1| glutaredoxin [Halomicrobium mukohataei DSM 12286]
    MSDTAITLYRLQACPFCERVVRRLQEYGLDYESRFVEPLHSERDAVKRLCGKRTVPAIVDEQTGVTMAESANIVDYLDRT
    YGEGGDD

    >gi|257387048|ref|YP_003176821.1| dihydrolipoamide dehydrogenase [Halomicrobium mukohataei DSM 12286]
    MVVGDVTTGTELLVVGGGPGGYVAAIRAAQLGVDTTLVERDAYGGTCLNHGCIPSKALISGADVAHRAGQAEEMGVYADP
    AVDLSGMVEWKDGVVTRLTRGVESLAKSAGVELIEGEATFTGEHTARIAHGGDGQGSETVEFEHAIVATGSRPIQVPGFE
    FDADPILSSKEALALESLPERLLVVGAGYIGMELSTVFQKLGSEVTVVEMLDEALPGFEDDIATLVRERAEEIGVDFYFG
    EAADSWEQAGEEIVVHTEDEDGDLTRFDAEKALVAVGRQAVTDGLGLDELGIEPDEDGFLATDEQARTDAEHVFAVGDVA
    GEPMLAHKAMAEGEVAAEVVAGEPAALDHQAIPAAVFTEPEIGTVGMTEAEAADAGFDPVVGQMPMRANGRALTVDEKAG
    FVRIVADDETGFVLGAQIVGPEASESIAEVGLAIEMGATLEDIAGTIHTHPTLSEAVHEAALAARGEAIHTR

    >gi|257387205|ref|YP_003176978.1| Rhodanese domain protein [Halomicrobium mukohataei DSM 12286]
    MTDIVSQSWLAERLDDVRVVDVRDAWEYDGIGHLPGAVNVPFDAFRADESGEHDEGMLPGRAHFAALLSEAGISNGDEIV
    AYDDTHGVFAARFLVTAALYGHDPAALHLLDGDFSAWQLERETTGETPAPTPTEYAIEPPAETPLVDADAVAEAVGGDAV
    IVDTREGWEYEEGHIPGAVQLDWRELVDDDSRGLRPEAEIRELLESRGIVPDARIVLY
    CNTARRISHTYVVLCHLGYDNL
    AFYEGSLTEWTAQDRPLETGEN

    >gi|257387206|ref|YP_003176979.1| Rhodanese domain protein [Halomicrobium mukohataei DSM 12286]
    MDGVHILVCIMSDYANDVLVTADWVEDNLDSFQSDDPDHRLVEVDVDTEAYDEAHAPGAIGFNWETQLQDQTTRDILSKA
    DFEDLLGSHGISEDSTVVLYGDNSNWFAAYTYWQFKYYGHDDVRLLDGGREYWLDNDYTTTDEVPEFSAVEYEASGPRES
    IRAYRDDVENAIEKNLPLVDVRSPEEFSGEVLAPPGLQETAQRGGHVPGAKNISWAAVTNDDGRFKDFDELQELYADEDI
    DGDETTVAY
    CRIGERSSVAWFALHELLGYDDAVNYDGSWTEWGNLVGAPIEKGEADD

    >gi|257387717|ref|YP_003177490.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Halomicrobium mukohataei DSM 12286]
    MTHVVIIGAYGSAGAAVAGELAEEPGIELTLIDDGEPGGGLCILRGCMPSKEVLSAGAHRFQARHDDRLVGDAPEVDLER
    TVERKDDHTLGWAGHRRAGIEELAERDDVRFVHDTARFVDPHTVRAGGEEFDADYVVVATGSSVNVPDVPGIDEVEFMTS
    ADVLDATDFPDSGIVMGFGYIGMEMVPYLAEAGGMDLTVVEHDDRPIDEADPEFGDAALELYRNHWDLEIPTNCHERRLE
    ATDDGGVRLTVEFEDDGADGPTRETYEADQLFCFTGRRPTVEGLGLDNTEIAVSGDWVRETMQTAAHDHVYAVGDVNGKE
    PILHVAKEQGFTAAENIRRQEAGNAPQPYENVHHHVIFSGLGVYPFARVGHNEQTAREAGHDIAVATRQASDDGVFKSKY
    VPEGLAKLVVDRADGTVLGWQGMHYHADSFAKTMQIVVEMGLDVRELPDRSYHPTLPENLDGLFRDAADAVEQ

    >gi|257388098|ref|YP_003177871.1| glutaredoxin-like protein [Halomicrobium mukohataei DSM 12286]
    MTFNPNEGLPQDEVTERVDEAIESNEVVLFMKGTEMMPQCGYSDKALTLIGQCRDDFETVDVLESLDEYRVALEEHSGRE
    TIPQTFVDGEFVGGSDILEQYAERGELEATLLA

    >gi|257388140|ref|YP_003177913.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halomicrobium mukohataei DSM 12286]
    MLEAGDTAPTFELPEQDGETVALSEYEGQRVVLYFYPRADTPGCTKEACGFRDEWDAFADRNVAVLGVSDDPVDDLAAFA
    AEYDLPFTLLSDEDGAVAARYDSYGEKNMFGNTFDGVFRNTYVIDPDGVIERVYEGVSPEGHAEEILADLD

    >gi|257388199|ref|YP_003177972.1| Redoxin domain protein [Halomicrobium mukohataei DSM 12286]
    MVALDSEDDVLQRGDEAPVFELPGTDGESYTLDAFADREALLVVFTCNHCPYAQAKFDELNHLAAEYDEVAVVGINANDP
    EEYPDDSFEKMRELVDDGTVDYDAYLFDESQEIAAAYGARCTPDPFLFVDDGGTFRLAYHGRLDDATNPDDEPTEREMKA
    HIETLLAGEEITAEAKPSRGCSIKWKPGNEPDYWDA

    >gi|257388360|ref|YP_003178133.1| protein of unknown function DUF255 [Halomicrobium mukohataei DSM 12286]
    MSSDSGPTDRNRLDEAESPYLRQHADNPVNWQPWDEQALETAREHDAPIFLSIGYSACHWCHVMEDESFSDPETATLLNE
    HFVPIKVDREERPDLDAIYMSICQQVTGRGGWPLSAWLTPDGEPFYVGTYFPPEERRGMPAFGQLLEDIAGSWSDSEQRE
    EMYNRARQWTDAIESDVGDVGQPGDVPDDEALQAAVDAAIRAADREHGGWGNGPKFPQPGRLHYLMREVARSDRDDVRSV
    VTETLDAMADGGLFDHVGGGFHRYCTDREWVVPHFEKMLYDNATLPRAYLAGYQLTGDERYAEVARETFAFVERELTHED
    GGFFSTLDAQSVPPAGRREDADAEPEEGAYFVWIPDEVRAAVDSETAADLLCDRFGITESGNFEGKTVLTVDASIEALSE
    SSGLEASDVERTLASAREQVFEAREERPRPARDEKVLAGWNGLMITAIAEGAIVLDDVDPDPAADALAFVREHLWDESEQ
    RLARRYKDGDVAIDGYLEDYAFLARGALTLFEATGEVEHLAFALDLAHAIEREFWDADDGTLYFTPTSGESLVARPQELT
    DQSTPSSTGVAVQALLSLSAFVPHDRFETIAAGVLETHANKIEANPMQHASLVVAADRYLRGDLELTLVADEVPAEWRTT
    LAETYLPDRLLAWRPPGDGDLDAWLDVLGLDDVPPIWADRTERDGEATVYACRQFTCSPPQHHLRNALDWATEQA

    >gi|257388371|ref|YP_003178144.1| DSBA oxidoreductase [Halomicrobium mukohataei DSM 12286]
    MDEHSPTRRSLLLAGGAAAASLAGCLDSSSGGSEQPDGTATVTTGSISTPVAGDPEADVTVAVYEDFACPHCATFNQEVY
    PDIRSEYVDSGAIRYEHHDFPLPVDQSVSLEAPNAARAVQDGVGDEAFFEYADLLFENQGSLGPDRYASLAREVDADPST
    VKTAAVEQAYEATIEADREGGIDAGVDRTPTALVDGEKVEASYEALSAAIDAAQSDST

    >gi|257388411|ref|YP_003178184.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halomicrobium mukohataei DSM 12286]
    MFTATVGTSDHEPFDLSDHVGDGPVVLAFFPGAFTPPCSNEMVALQNHLADFEAAGATLLGVSADSPFSQGAFREEHGIE
    FDLVSDMSGEAIRAYDLEMDIEELGLHGIANRAVFVIDDDGTVSYSWVADDPTNEPDYDDVLAAVEAAA

    >gi|257388458|ref|YP_003178231.1| thioredoxin reductase [Halomicrobium mukohataei DSM 12286]
    MTDDVVEHRRLIIAGTGIAGLTAAIYAARSNNDPLVFEGDEPGGQLTLTTDVANYPGFPEGISGPDLVNDMKEQAQQFGA
    ELDHGIVENVDASDRPFRVELANGDAYTADAVIAASGASARTLGVPGEDELMGYGVST
    CATCDGAFFRDEDMLVVGGGDA
    AMEEATFLTKFADTVYLAHRREEFRAEDYWIDRVQEQVEDGDIEIMRNTELLEIHGSAEDGVDHVTLARNDEGYPSEALD
    DPETEQFDFDVGAVFLAIGHTPNTGYLEDTGVELDDAGYLQTESGVGDGETATAVEGLFGAGDVVDHHYQQAVTAAGMGC
    KAALDADEYLESLPESSQAAETAPQADD

    >gi|257388494|ref|YP_003178267.1| iron-sulfur cluster assembly accessory protein [Halomicrobium mukohataei DSM 12286]
    MSSTVDADPGGTGIDVTEPAAAEAVDLMEGEQMDVDEAGLRLFVQQGGCAGLSYGMRFEHEPEPDDQVYEHHGLRVFIDQ
    SSLNYIEGSVLDFEGGLQGEGFHVRNPNVESECGCGESFRT

    >gi|257388665|ref|YP_003178438.1| glutaredoxin [Halomicrobium mukohataei DSM 12286]
    MGITLYQLEGCPYCEAVAERLDELDIEYDSVWVEPRHSERDAVKRVSGQRGVPVLVDEDRGVTMAESERILEFVERSYAR
    PGVETT

    >gi|257388667|ref|YP_003178440.1| methionine-R-sulfoxide reductase [Halomicrobium mukohataei DSM 12286]
    MSEKTTDETADNDEEWREILTEEEYRVLREQGTEPRFSSDLIDVKDDGQFQCAGCGTALFDSGEKFDSETGWPSFWDVYD
    EGAIETRRDTSHGMDRTEVVCANCEGHLGHVFDDGPEPTGKRY
    CINGAALEFEGDE

    >gi|257388723|ref|YP_003178496.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halomicrobium mukohataei DSM 12286]
    MLSTGDEAPSFTAPLANGDIESFTLTDRLDEAPIVLAFFPGAFTGVCTHEMNTFQDRLDDFSEAGASVYGVSIDTPFSQN
    EFRDKLGLEFDLLSDSNREVVDEWGLSMDFDELGVDGVAKRSVFVIDGDGVVQYAWVSDDPGVEPEYDDVLDAVEAI

    >gi|257388732|ref|YP_003178505.1| heavy metal translocating P-type ATPase [Halomicrobium mukohataei DSM 12286]
    MKQEPVSIHEMSTRTTRLSVTGMSCANCAATIEDALDALDGVASADVNAATDEGRVEYDPEVTSLSAIYDAVESAGYGAV
    DETVSVGITDMS
    CANCAEANAESLLATPGVVAADVNYATDEAQVRYNPAEADRSDLYDAIESAGYTPVREAGDDSGDGGD
    DRDQRDLARQAEIRRQLRLTLFGGALSVPLLVMLVDHVLGLGLLGDSLAGIDVGWFAFALATPVQIALGKPFYVNSYRAL
    VRNGRANMDVLIALGSSTAYVYSVAALIGLIPGAGLYFDTAALILVFITLGNYLEARSKGQAGEAIRSLLEMEAETATVV
    HEDGTEEEVPLEAVAVGDRLKVRPGEKVPTDGVVVDGESAVDESMVTGESVPVEKAEGDEVIGSTINENGALVVEATKVG
    EETAIQQIVARVRDAQSRQPDIQRIADRISAYFVPAVIANALLWGVLWWQFPAVLGGFVDALPLWGLLGGGPEAVGGPIG
    VTEFAIVVFASAVLIACPCALGLATPAATMVGTAIGAQHGVLFEGGDILERVRDVDAVVFDKTGTLTEGEMELTDVVALD
    PAAPDGGVQRGGHETASGFDEDDVLAMAASAEQESEHPLAEAIVEGARERGLTLDSPEAFENVPGKGVRATIDRGEVFVG
    SPRLLDANGIDPTPADSDRERLESEGKTAMLVGLRPRDADGEIDERAGRVVGVVADADTIKPSASDAVADLRDRDLDVWL
    ITGDNERTARAVARAVGIDPDNVMAEVLPEDKADAVDEIQSDGREAMMVGDGVNDAPALATAAVGCAIGSGTDVAIEAAD
    VTLMRDDPADVLKAIRVSEATLQKIKQNLVWALGYNTLMIPLASLGLLQPVLAAGAMALSSVSVLTNSLLFRGYTPDTDY
    RLLGRLR

    >gi|257388840|ref|YP_003178613.1| hypothetical protein Hmuk_2801 [Halomicrobium mukohataei DSM 12286]
    MSTVEIEYCVPCGFRERAIEMSEAILNGCERELDELSLVMGDHGVFRVNVDGETVYDKAEDSAELDEVVRTVRSAL

    >gi|257389011|ref|YP_003178784.1| DsbA-like thioredoxin domain-containing protein [Halomicrobium mukohataei DSM 12286]
    MDDLTRRRLLGGTAGLVAGTAGCVGGDANTDADATPTDRELMTSGSSDVDFDHPSATGINDQPTLGDRGRQGVIVAFEDP
    S
    CPTCRRFHRNTFPQIESELLAPGDVAYVFRGYPVVYEWGGPATRALEATFARDPAAVWDLKAHYFDQQGQFSTDNVLDR
    TRSYLDDATNVDGSAVVTAVSEDAAAQAVQTDYDAGQAAGASGTPTFYLFRDGEYQTTVSGAQDFTVFENVLLG