Halogeometricum borinquense DSM 11551 uid54919

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|313124843|ref|YP_004035107.1| peroxiredoxin [Halogeometricum borinquense DSM 11551]
    MSTTTAPLDFELPNVGAGPDTFSPADADAEYLVLLLQRDYYCKKCRRQVQSAKRRYDEFQDANAEVVSVLPEPTDRTKKW
    QTSYDLPFPLLADEGKEVGDAMDQPERFGVLGSLHDLVGRMPEALVLDVETGEVLFDHAGDSPGDRPDIDELLAAIPSA

    >gi|313124983|ref|YP_004035247.1| rhodanese-related sulfurtransferase [Halogeometricum borinquense DSM 11551]
    MSTDGYAKDVLVSPEWVEDHLDEFQSDDPAYRLVEVDVDTEAYDEGHAPGAIGFNWETQLQDQTTRDILTKEEFEDLLGS
    HGISEDSTVVLYGDNSNWFAAYTYWQFKYYGHDDVRLLNGGRDYWLENDFPLSEEAPDFDAVEYNAKGPFESIRAYRDDV
    QHAVDEGLPLVDVRSPEEFSGEILAPPGLQETAQRGGHIPGAENISWAATVNADGTFKSAEELEELYADQGIDGNETTVA
    Y
    CRIGERSSIAWFALHELLGYDEVVNYDGSWTEWGNLVGAPIEKGN

    >gi|313124984|ref|YP_004035248.1| rhodanese-related sulfurtransferase [Halogeometricum borinquense DSM 11551]
    MYETVVVSPDWVESRRDEIRLVDVRDAWEFDGIGHVPGAVNIPFDEFRSADGDEGMLPGADVWESLLSAAGIGPDDHLVA
    YDDTHGVFAARFLVTAELYGHPTERLHLLDGDYSAWNRDRETTSAATDATETTYEIRDPEHSPLVEYEFVLDSLDDEAAV
    VVDTREAWEFEEGHLPGAVNLDWRELVDDETRGLKPADELEAILDEVGITPDRRVVLY
    CNTARRISHTYVVLRSLGYENI
    AFYEGSLTEWEERGGPIETAE

    >gi|313125079|ref|YP_004035343.1| dihydrolipoamide dehydrogenase [Halogeometricum borinquense DSM 11551]
    MVVGDISTGTEVLVIGAGPGGYVAAIRAAQNGLDTTLVEKDAYGGTCLNHGCIPSKAFITASSLAHEAGHAEEMGIHANP
    AVDMSQLRNWKDGVVDQLTGGVEKLCKANGVNLIEGTARFKDDGAVRIEHGGEGQGSETVEFEHCIIATGSRPIQVPGFE
    FADDAVWSSRDALAADSVPDDLVVVGAGYIGMELSTTFAKLGANVTVVEMLDDVLPGYEDDVARVVRKHAESLGVKFHFG
    EGASGWSPDGEDVVVETETEDGEISTYRADKVLVAVGRSPVTDTLDIENAGLEPNENGFLETDDRMRTDVEHIYAIGDVV
    ADSPMLAHVGSKEGIVAAEHIADEPVAYDAQAVPAAVFTEPEIGTVGMTQAEAEEAGFTPVVGKMPFNASGRALTTGHTD
    GFVRIVADEDSGFILGAQIVGPEASELVAELALAIEMGATLEDVAGTIHTHPTLAEAVMEAAENAQGQAIHTLNR

    >gi|313125185|ref|YP_004035449.1| heavy metal-translocating p-type ATPase, cd/co/hg/pb/zn-transporting [Halogeometricum borinquense DSM 11551]
    MNRDSHDTEEAGHDHGRDHPPSSDDTEACGCDDGCDTDESSTSVASGFDGDGQTLRLSVPEMDCPSCAEKVTKSVRGDAG
    VRDVDAQPTTGTLYVQYDPTATDDSAVRSRVESAGYAIADEETVTFSVPEMD
    CPSCAGKVENSLDGVSGIVDFETQPTAG
    KVTIRYNPDEASRGDFVAAIEGAGYAVEDDGGADSPHDVWRSQRALKTWGGAAFLAVGLGLEFVVEGLDLVLAAPVGYEI
    SVAWVSYTLAVLLAGIPILRNGYYSAKNLSLDIDLLMTAGIVGAMAVNMPFEAATLAVLFSVAELLERFSMDRARNSLRE
    LMELSPDTATVLRNSGSSKTSQAEREEVVVPVEDVAVGETVIVRPGDRVPLDGTVTEGTSAVDESPITGESVPVDKEPGL
    EVFAGSIVEEGYLEIETTTPASESTLSKVVDMVEDANREKTEAERFIDRFARYYTPIIVVGAIATATVPPLLFEEPFRMW
    FVRALTLLVVACPCAFVISTPVSVVSGITSAARNGVLVKGGQHLEAMNDVDAVAVDKTGTLTTGELGVTDVVALNGNDES
    DVLGCAAAIESRSEHPIAQAIVEYAADRDVPERDIREFESITGKGVKAVLDDKVHYAGKPGLFESLGFDLEHTHVQADGG
    VRSDGGQAVEDARNCDHGRYLDLANEVVPRLQAEGKSVVLVGTEDEIEGVVAVADTVRPESAWAVSRLHDHGISQVVMLT
    GDNERTAQVIGERVGVDEVRADLLPEQKVEAVRELLAEHDSVAMVGDGVNDAPALAAATVGVAMGAAGTDTALETADVAL
    LSDDLTRLPYLVDLSNGTSSVIRQNVWSSLVVKGALAVAAPLGIISVATAIIVGDMGMSLGVTTNALRLAGVDPESAVAD
    AEADPGDAESSVDDSLADTSAA

    >gi|313125211|ref|YP_004035475.1| NAD(fad)-dependent dehydrogenase [Halogeometricum borinquense DSM 11551]
    MSDPFVVVGGDAAGLSAASKCRREDPERAVLVFEKGRWVSYAHCGTPYFVKGEVDSLTDLLSLSPADIEDRGIDLRREHE
    VVAVDTDAQTVTVRGPDSKFTQSYGDLLVATGGSAVSAPIEGFHLDGAFTMHGLDHAAAVRAFLADPGEFSVGDLGGATD
    VDRDMAARYGAMEPPETVAVVGGGYVGVEMAEAFSAHDLDVHVFQRPNRLLSPFGEAVGERVADHLREQGVTLHLGEEVA
    ALRGEGQVETVVCGSGTKLAVDAALVGIGIQPNTALIEETPVELGDSGAIATDEFGRTTVENVYAAGDVAEMRHVVTDDP
    TWDPLGLPANRAGRAIGSTVAGTPEPVGGVAGTAVVKAFELECGRAGILDYERARTAGFDPVSETITAGSRSGYYPGGSE
    TTVTLTADRSSGRLLGGSIVGADRAAIRIDTIATALGSKMTVAELERQDLAYAPPFSPVWDPILVAAKVLGGRL

    >gi|313125216|ref|YP_004035480.1| copper chaperone [Halogeometricum borinquense DSM 11551]
    MSQTLTVEGMSCGHCEQTVEDALSNVDGVESAAADHESASVTVRGDVSVNKLVTAVEDAGYDASA

    >gi|313125318|ref|YP_004035582.1| rhodanese-related sulfurtransferase [Halogeometricum borinquense DSM 11551]
    MDDEIDPSEVESLLDSEDPPRVVDIRSPGSFARFHIPGSENVPFAELPDRVASLEGADRIVTVCPHGKASIQAARLIKSY
    EGTADARVESMRGGLEAWEGPLEEQKTAAEPDEGPEAPF

    >gi|313125388|ref|YP_004035652.1| o-6-methylguanine DNA methyltransferase [Halogeometricum borinquense DSM 11551]
    MQVTVFDIDVELDESITDSEPTSIRNQIAAYERGERSTFDVDIRFPEGLTGAVMRCMRQIPYGETRTYGEIATELQTAPV
    AVGQACGRNPVPILVP
    CHRIVGTESLGGFSAGGEHGETLKHRLLALERADAVTDGVQATLDDITTARNQAQPEK

    >gi|313125447|ref|YP_004035711.1| methionine-r-sulfoxide reductase [Halogeometricum borinquense DSM 11551]
    MSERRSEDVPTTDEEWRERLSEEEYHILRERGTEPRFSGDHVDRDEDGAYLCTGCGAELFDAETKFDSGCGWPSFFAAHD
    DAIETETDTRHGMRRIEVLCENCGGHLGHVFDDGPEPTGKRY
    CINSVALEFDPDE

    >gi|313125463|ref|YP_004035727.1| glutathione s-transferase [Halogeometricum borinquense DSM 11551]
    MGRLIDGHWKTTDELTENDQNRSDDGFRERISPDSRYPPESGRYHLYIARACPWAHGAALVRKLLGLEDVISLDIVDPYR
    GAGGWQFTPDKPGCTPDSIHDSDFLHEVYTAADPEYSGGVTTPVLWDRENGTIVNNESIEIMQMLATAFADHSDEYDLYP
    AGKRDRIDAVVEKLHEPILQGAYTAGFAESQDTYERAVETMFDALNHWEGVLGDQRFLVGDSLTIADLRLFPALVRFDPV
    YYTHFKCNIRRLVDYPNLWGYTRDIYQHDGVSETVTLDHIKKHYYRSHTDINPTGFVPVGPDIDFTAPHSRTE

    >gi|313125536|ref|YP_004035800.1| hypothetical protein Hbor_07630 [Halogeometricum borinquense DSM 11551]
    MTDDETRVEWHKWGPEAFEEARADEKPVLLSLTATWCDGCHEMDVETYGEPRIAANVNDDFVPVRVDVDRHPRVRERYNM
    GGFPSTVFCTPSGELITGAMYLGPDGMRQVLDRVRETWSEKGDSSGRVPRALADDPTPEGPVESHIEEHLAGQLDEKYDD
    RFAGWGDGTKFPMPRTIEFALKRSRRQAVETLRTIAETLFDDVEGGFFRYADGRDWSDPHHEKLLDSNAALVRAFANGYL
    YTGDDDLLNPAMETRDFLADRLWNGAAFGGSVGPGDENYYGQTAEERAESAGPRRDLTAYAGANALAADALLTLTAYTDD
    GTARDYAVRTLDFLDTRLIDDGDVTHFDAGETTGETHLLEDHARTVSAFVRARQVLGDDWYLDRAQAVADVAIDELKADG
    GAFRDGLASGSGLLDRPLRPLDANVEMANALCDLAAATGEEPYEDAAQEAIGAFAGAWDRIGVQVAGYGSVAARVTRPTL
    VVAVGATAGSDLHRAALRVADHEKVVVPDADGVSASEAVVSLGDRERTVTTPEQLMTAVSDITDGV

    >gi|313125600|ref|YP_004035864.1| glutaredoxin-like protein [Halogeometricum borinquense DSM 11551]
    MLAGFELDTMSITVYALDGCPYCEKVHDALEEHGVEYETEWVEALHSERNEVKRVSGQRSVPVLVDDERGITMGESDNIV
    QYIERTLA

    >gi|313125759|ref|YP_004036029.1| dithiol-disulfide isomerase involved in polyketide biosynthesis [Halogeometricum borinquense DSM 11551]
    MSDSESAEYAEQITVYSDYVCPFCYLGRESLRRYQSTREDELEIDWHPFDLRSQKRNPDGTIDHSVDDGKDDEYYEQAKE
    NVRRLQEKYGVEMDLDVDTDIDSLPAQMASYYVKQHYDYETWLDFDVAIFDALWQDGADIGDEELLVKLAEDAGVVGDEI
    RSALDDDALREEVRAQFTEAHQQGVTGVPTFAYDGYGARGAVPPEHLERLVEGV

    >gi|313125899|ref|YP_004036169.1| iron-sulfur cluster assembly accessory protein [Halogeometricum borinquense DSM 11551]
    MSTETVDGGTDAAVTVTESAASEALRLMESEGMDTDVAGLRLFVQQGGCAGLSYGMRFDHEPEDDDAVIKQNGLRVFIDP
    ASQNYIGGSTLQFEGGLQGAGFHVENPNVVSECGCGESFRT

    >gi|313125918|ref|YP_004036188.1| peroxiredoxin [Halogeometricum borinquense DSM 11551]
    MLNVGDEAPDFELQNQDGEKVSLSDFENEYVVVYFYPRANTPGCTTEACEFRDASNEFEAHDATVLGISDDPISDLEEFA
    DDHDLSFPLLSDEDGAVASAYDSYGEKNMFGNTFDGVFRNSYVVAPDGTIAFAYEGVSPEGHAEEILSDLKAHRESSD

    >gi|313126021|ref|YP_004036291.1| thioredoxin domain-containing protein [Halogeometricum borinquense DSM 11551]
    MTAEAPTTGTPSRPLSIESEAELDELIAENDLVLIDFYTKGCTLCQSIEPVLGNVARAHDNLTVALCNPREDPPLIERFN
    IQSVPTLVLFEDGERAGRLADGFQGGAAIDDFLAESRSDT

    >gi|313126304|ref|YP_004036574.1| hypothetical protein Hbor_15590 [Halogeometricum borinquense DSM 11551]
    MSDALGRNRLADEQSPYLQQHADNPVNWQPWDETAIEAAREKDRPIFLSVGYSACHWCHVMADESFEDDDVAAVLNESFV
    PVKVDREERPDLDRIYQTICQLVTGGGGWPLSVWLTPQGKPFYVGTYFPKEERRDRGNVPGFLDLCRSFAEAWENDREEI
    ENRAQQWTAAIQDQLEATPDDPGESPGTEILGEVAKAALRGADREYGGFGSGGPKFPQPGRVEALLRSYVHSGEDEPLTV
    AMETLDAMAGGGMYDHVGGGFHRYATDRQWTVPHFEKMLYDNAEIPRVYLAAHRLTGRADYAEVARETFDFVARELRHPD
    GGFFSTLDAQSGGEEGTFYVWTPEQVHEALADETRAEVFCDYYGVTSGGNFENGTTVLTVSATVDSVADEHGLTTDEVTD
    HLDAARETLFDTRESRTRPPRDEKVLAGWNGLMISSLAQGALVLGDEYAELAADALGFAREHLWDESEGRLSRRFKDGDV
    KGEGYLEDYAFLARGAFDLYQATGDVDHLAFAVELAREIVASFYDDAAGTLYFTPDDGEALVTRPQELQDQSTPSSVGVA
    TSLLLDLDAFAPDADFAAVAGSVLDTHADRIRGRPLEHVSLALAAEKRARGGSEIVVAGDSLPDSFRQSLAERYVPDAVL
    SIRPPTDDDLTPWLDTLGVEDAPPVWQGREMRDGEPTVYACEGRACSPPTHSVEEALSWFGGGDDVDVELDDADIDLDET
    DLDID

    >gi|313126390|ref|YP_004036660.1| NADH dehydrogenase, fad-containing subunit [Halogeometricum borinquense DSM 11551]
    MSTQVVVLGSGYAGTGAVKRLEEELGPDAELTWVSENDYHLVLHEVHRCIREPSAESNVAIPIDEIKEPQTEFVKGHVEN
    IDVEDRVVELEDGDVEYDYLLVCLGSATAFYGIEGLQEFSHELKSLDDAREIHSDIKAAAEDASRDDPAKVIVGGAGLSG
    IQTAGEIAGYRDEHRAPIDITLVEGLDEVFPGNDPELQGALRKRLEARDVEILTGDFISKVDEENVYLGGGEDEDPEELD
    YDVLIWTGGITGQEEVADADIEKDERSNRIFTDADFQTSDERVFAIGDSALIEQGTDSVAPPTAQAAWQAAEVAGENVAR
    TVRGQPLKTWTHNDKGTVVSIGDDAVAHAVKLPGLGKLPINVFGGPAARALKKGIAAKWISDVTDARRAVEAWDSL

    >gi|313126489|ref|YP_004036759.1| zn-dependent hydrolase, glyoxylase [Halogeometricum borinquense DSM 11551]
    MTPEELHDRLERGESVTLLDVRNREEYDAWHIDGDSVTTTLVPYSKFMTAEVQGTVEETARKAGLDPDELVVAVCGRGEA
    SDYVAELLRDVGYNAENLEDGMRGWAHVYVSETVPTDADATVFQYRRPSSGCLAYMLVSSGEAAVIDPLRQFVDRYAADA
    REYGADIVSVIDTHVHADHVSGVRELADAVDATPVYPAAAEARGLVADSATKLVSDGDEIHVGDVTLTAVHTPGHTSEMT
    AFQIDDSCFSGDGLFLDSVARPDLEHGDEGAEDAARRLYETFQSVYGTFDDDVRVAPAHCGEATERAVDGTYTARLGTLR
    DRLPALSMDEAEFVEYVLDDMPPRPANYEEIIEMNLGRSEVEDDEAFELELGPNNCAVSQAD

    >gi|313126610|ref|YP_004036880.1| transporter component [Halogeometricum borinquense DSM 11551]
    MVGLSLSAAGATVPLVVVGDLFPNGWIDYALGGVLIGLGVSVIYLSTGIIAGASTFLESTLSYVSDLPRFNRGKYVRSRD
    WRVVFTGGIVLGAALYTVTLGPGGWTTQVQPWRLFLGGTLVGVGTRLGKG
    CTSGHGVCGIGSGSNTSFVNVATFMLLAIG
    TAQLVAALGVSP

    >gi|313126633|ref|YP_004036903.1| thioredoxin [Halogeometricum borinquense DSM 11551]
    MSTPESRGTPVHVESQDHLEELVAGENVVLVDFYADWCGPCKMLEPTVDEIAAETDALVLKVDIDELQELARDQGIRSVP
    TLQFYADGEQAKQVIGVQDKDDLVEVVEQLSS

    >gi|313126720|ref|YP_004036990.1| peroxiredoxin [Halogeometricum borinquense DSM 11551]
    MVLKESDSNLSHGDVAPDFSLPGTDGETYTLDSFADYDALLVVFTCNHCPYAQAKFDELNYLARTYDELAVVGINPNDAE
    EYPDDSFDRMQELVEDGTIQYTAYLRDESQDVAREYGAVCTPDPFLFEKEGDEFVLRFQSRIDDAMSPDDEVTDYEMRTS
    VEAVIGGDEIPLDEIPSQGCSIKWRD

    >gi|313126726|ref|YP_004036996.1| protein-disulfide isomerase [Halogeometricum borinquense DSM 11551]
    MRTTRRSYLAAAGGALAATAGCLGGSDSQSKPSCEVGDLEQVKSLPTPTLGPEDADVTVDVYEDFACPHCATYNVDVFPK
    VKQNYIDTGKIRYRFFDFPIPVSKQWSWGGAIAARAVQDRTDDETYFKYAKRLFEKQNELTSNGYTVIHDVANEFDVDGC
    EVMASVEQDIYRSVVKSDRQRGIEVDIGGTPAIIVNGEHLSGAGWETVKNGIEGHLKSASKS

    >gi|313126727|ref|YP_004036997.1| thiol-disulfide isomerase-like thioredoxin [Halogeometricum borinquense DSM 11551]
    MKRRELIAGVGSLAVVGGAGYVALNGVGLGDDGLPLTVQTLDAPGSEAGKRPVPAPGKPTVLDLFATWCVPCSAQMESLT
    ALHEEFGDDVAFVSVTNEGFGDNLTADDVRKWWADHDGAWTVGHDPESRLMKVLGAGGLPYLAVFDADGTATWTHRGLAS
    ESNLRAQITAVL

    >gi|313126750|ref|YP_004037020.1| alkylhydroperoxidase ahpd family core domain [Halogeometricum borinquense DSM 11551]
    MVELDDDAMTRFPVPDEDELPADLRERIEEETERSGFTPNVFAAFAYKPSHFRAFFDYHDALVDDTALDREEVEMIVVAV
    SGVNHCYY
    CNVAHGALVRIYAKDPTLADQLVANYRQADISEKRMAMLDVAVKLTESPREVTEDDLDRLAEVGYSEEAMWD
    IASVTAFFNLSNRMAMFADMRPNDEFHSLGRTQNVDSDK

    >gi|313126818|ref|YP_004037088.1| peroxiredoxin [Halogeometricum borinquense DSM 11551]
    MVDVGDDAPDFTAPLADGDVESFTLSEHLDEAPIVLAFFPAAFTSTCTTEMCTFRDRMANFEDIGATVYGASIDTPFTLN
    EFREQNDLNFALISDTNRELIHEYDVAMDFDSLGVHNVAKRAVFVVDTDGTVSYAWVSDDPGAEPDYDEVAAAAETMRA

    >gi|313126860|ref|YP_004037130.1| thioredoxin reductase [Halogeometricum borinquense DSM 11551]
    MTEDDDAFVEHRKLIIAGSGISGLSAAIYAGRSNNEPLVFEGDEPGGQLTLTTEVENYPGFPEGISGPELIQNMKEQAER
    FGAEIDHGIVESVSADERPFTVTMKNGDVYTADAIIAASGASARTLGIPGEDELMGYGLST
    CATCDGAFFRGEKILVIGG
    GDAAMEEASFLTKFASKVYIAHRREEFRAEDYWVDRVMEKVEDDEIELMRNTEVTELHGTPEDGVDHVTMVRHPEGHPTD
    KLDDPETEEFDFDVGAVFYAIGHTPNADYLEGTGVERDDDGYVKAKGGTGGGQTATDVPGIFAAGDVVDYHYQQAATAGG
    DGVKAALDADDYLENLEREAEATEVEPAAAESDD

    >gi|313126900|ref|YP_004037170.1| thioredoxin [Halogeometricum borinquense DSM 11551]
    MSEKSSDADELDEIRRRKRKQLESKLEDGTSPETDRMSAESPADPIDVNGGDEFESLVASTSVVLVDFYADWCGPCKMIA
    PTVNSLAAETTATVAKVDIDQNQTLASQYNVRGVPTLLLFSDGDPVEQVVGVRDKSTLRGLIEQYT

    >gi|313126927|ref|YP_004037197.1| selt/selw/selh selenoprotein domain [Halogeometricum borinquense DSM 11551]
    MELIECPSFTFNSPDGKRSDMTEIEIEYCVPCGFLDRAETIQHAVLQQFGERVNRVSLVTGDHGVLTVAVDDEIVWDKAD
    DEYDVDEITRRVRSAL

    >gi|313126939|ref|YP_004037209.1| ABC Fe3+-hydroxamate transporter, periplasmic component [Halogeometricum borinquense DSM 11551]
    MRVVSLLPSATELLYGLGAEPLGVSHSCDYPPAARAKPVLTSTVIEYGDDRPPADIDRQTRNVEGSTYDIDVDLLADLDP
    DLVVTQATCEV
    CAVDASDVFEAVERRGIDADVLTLDPHSLSDILDDLTRVGEAIGASDTAASLRAELEARIERVTDRAAA
    AMDRPRTAVLDWTDPVIAGGHWVPEMIERAGGTPGLVTDGPSTPQHWDDVRAFDPEVLIVAPCGFDVERGTDAISDLRSK
    DGWANLTAVQDGNVYVVDGNGYVNRPGPRLVDSLELFASCIHPDRFEAPAPAVVRRVGAVPP

    >gi|313126948|ref|YP_004037218.1| thioredoxin reductase [Halogeometricum borinquense DSM 11551]
    MTEMGDAESYDVVVIGGGPAGLQTALYTARLGHDTAVVDRGGGRAAMMLDTHNVIGVTEEVSGNELLQTAREQVESYGAD
    FHRDLVTEATRLDDGRFHLVGNNSEFVADRIVLGMGFNDERPEPPVPRTGKGLHY
    CLHCDAYMFIDRPVFVMGTGESAAH
    VAMIMLNFTDEVDILLRGEEPAWSEETDERLRAHPIDIIETEISGMRKSDNGWLEAFEFEDGTVRNYRGGFPMYGSNYST
    DLAEQLGCDLNEDGTVAVSEDGETSVEGVYAVGDITPGHNQIPVAMGKGAQAGLAIHYELREFPRSLDDVRENGAVTRDE
    VPGLGDRIHAAADEFEEARAPPIQSPEVESAVDDD

    >gi|313127006|ref|YP_004037276.1| glutaredoxin-related protein [Halogeometricum borinquense DSM 11551]
    MTFEPGNDLSEEDVQERVDELIESNEVVLFMKGNQLMPQCGYSARALELIGKHRESFETVDVLPALDAYRAALEEHSGWE
    TIPQTFVDGEFVGGSDILAELDERGELGETLSA

    >gi|313127154|ref|YP_004037424.1| ABC Fe3+-hydroxamate transporter, periplasmic component [Halogeometricum borinquense DSM 11551]
    MGSAGAETTPRVVSLAPSSTATLTAMGAGDCLVGVTAHCDFDAPVVGGWLNPNYDRLAELDPDLVCTSDDLQSEIRDELR
    ERGYAVYHDEPERLTDVVESFESLGSAVGRPAAGEQLAEASRARLETVATRVPSDSDSRPIVYCEEWSDPPMAAGNWVPD
    AVAAAGGRCPFVKPGERSREVSREVVEGAAPDHVVLHLCGHGDRVSPGLFSERGWDVDATVHVLDDSLLNQPSPNLLDGI
    EALADLLHSDSHQHADTDGGH

    >gi|313127274|ref|YP_004037544.1| glutathione s-transferase [Halogeometricum borinquense DSM 11551]
    MLVDGEWRTDAYESTNEDGEFNRQETSFRNWIRDDADAEFPAESGRYHLYISRACPWAHRTAMTRRLKGLEDAISLSVVE
    PVRINDGWEFSAEYPDPLYGEDYLRDIYTRADDEFTGRVTVPVLWDKERETIVNNESREIMRMLDTEFDAHAKHDVDLWP
    EGYREEVDESIDSIYEPINNGVYRAGFADSQDAYDEAITELFDALDHWESVLEDQRFVVGDVLTEADIAMFVTLIRFDHV
    YHTHFKCNRRAIHEYPNLWNYTKELAQLPGVAETINIDHITRHYYMSHGDVNPKRLVPVGPDIDFYDDHDRDRLPADLPA
    VLRGDAAPANE

    >gi|313127349|ref|YP_004037619.1| peroxiredoxin [Halogeometricum borinquense DSM 11551]
    MSLNGTDAPDFTLASTNGADVTLSKTLDDGPTVILINRGHWCSFCAEQLQTFSEISYDLWFHDGVDILPIVTDPIGPVTE
    MRDRYDLGIQLLADPDGTVAEQYSGTEQTSHGLTGISATYVVDEEGVVQYEQVADHPADRTYGNWVRYFIRNGYEDPFEG


    >gi|313127361|ref|YP_004037631.1| peroxiredoxin [Halogeometricum borinquense DSM 11551]
    MSDVGIAVGETVPDVQQSLVQPDGETETASLSELVEEQPVLLNFYTVDFSPDCISEWCEFRDFDWFASGDAVQVVGASKS
    GERLHRKFISQFDLGFPLFADTTLELADAFGVRYKAFGLSHRAHRSCFLVDEEMTVRYKWIGEHWMDPTRDTPPVSEIHE
    AIVDELTIDQTETFGF

    >gi|313127380|ref|YP_004037650.1| rhodanese-related sulfurtransferase [Halogeometricum borinquense DSM 11551]
    MVTETDPETLVAKLEDDDSETTVVDIRDPSSYAAGHIEGAVNLPASRLSLSTVDTDWGDDVVVACYVGQSSRRVASLLDS
    HLDADVSSLRGGFDAWDGPTDSGYDV

    >gi|313127381|ref|YP_004037651.1| dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis [Halogeometricum borinquense DSM 11551]
    MSLSLDATQLDRYSRHIIMDEVGPPGQKRLLDASVLVVGAGGLGSPVIQYLAAAGVGHLGIVDDDVVERSNLQRQVVHRD
    DDVGTPKVESAAAFVHGLNPDVTVETYETRLEKENVGVLADYDVVVDASDNFPTRYLVNDFCRINEIPVAHGAIYKFEGQ
    VTTLTPDGPCYRCLFPEAPEPGTVPD
    CATTGVLGVLPGTVGCIQATEAVKLVLDEGDPLVGRLLFYDAMDMTFETVPYRR
    NSDCPVCGDDPIDSVADVEYTDACAVSLD

    >gi|313127390|ref|YP_004037660.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Halogeometricum borinquense DSM 11551]
    MTHVAIVGAYGSAGVAVADRLVEHVGAEIDRLTLVDDGEPGGGLCILRGCMPSKEVLSTAAHRYQMRHDHRLVGEPPEMD
    LEAVVETKNEHTSNFASHRRTAVHRMEEREGVAFRHETARFVDDRTLLVGDERIEADYVVVATGSSLNIPDLPGIGDVDY
    NTSADVLDATTLPDSGVVMGFGYIGLELVPYLSEAGVDLTVIEHDERPVDEGDPEYGDEILSMYREEFGVEIRTETRERR
    VERTDDGVRLHVEGPDGEDAIDAEALFLFTGRRPTLDGLELEAAGITPTGEEWVRNTMQTRADDNVYVVGDANGKEPILH
    VAKEQGHVAAENILADVNGGEHRTYENIHHHVIFSGASVYPYARVGHSVSSAEEAGLNYVAVHREASDDGVFKTKLAPRG
    RATLVVGTDGAVLGFQGLHYHADVMAKTMQVAVENEMDVRKIPDRAYHPTTPEILDGLLRSAAERLE

    >gi|313127475|ref|YP_004037745.1| thioredoxin domain-containing protein [Halogeometricum borinquense DSM 11551]
    MTVRLKDFYADWCGPCKTQDPILDELEEEYADVEFEKVDVDEEQDVANEYQVRSLPTLIIENDDGIVDRFVGVTQREDLE
    DALQKAGA

    >gi|313127550|ref|YP_004037820.1| glutathione s-transferase [Halogeometricum borinquense DSM 11551]
    MANLTLYELDGCPYCAKVTDKLAELGLEYDSIMVPRSHSERTEVKEVSGQTGVPVLVDEEHDVEGMPESDDIVAYLEETY
    GN

    >gi|313127601|ref|YP_004037871.1| peroxiredoxin [Halogeometricum borinquense DSM 11551]
    MLQLGQQAPAFSLPGAAGDDMDEHTLSEYVERGWSVILVFYPFDFHPACISQWCTLRDADWLTLLDDTVVLGIGGDSVYA
    HQEFARTYNIEFPLLTDSDGRVAEAYGVRESDFEGHRNVPGMALFVIDPDRTIQFAWRGDAADAEPDFDDVRKAANCHGD
    ECELSDDGAESADV

    >gi|313127653|ref|YP_004037923.1| glutaredoxin-like protein [Halogeometricum borinquense DSM 11551]
    MTGDTPAITVYRLQACPYCERVIRVLQELDVPYQSRFVEPMHSDRNVVKRISGKRTVPAIVDDETGVTMSESANIVKYLQ
    RTYGDGSDAGGAA

    >gi|313116928|ref|YP_004038052.1| copper/silver-translocating P-type ATPase [Halogeometricum borinquense DSM 11551]
    MNRRRSRIDIQGMSCANCSQTVADAVESVDGVSEANVNFATDEGTVEYDPEQVSLGAVYDAIDDAGYSPVAETTTIGITD
    MS
    CANCSETVQEALESTPGVVSADVNFATDEAQVTYNPAEASRPDFYSAIEDAGYSPVRENEGGEESAEDRRDAARKSEI
    RKQLRLTLFGAALSVPLLFFLVDKLILGGTLPEEVFGVQFGWVEFALATPVQGILGWPFYRNAYKALVKNRTANMDVLIA
    LGSSTAYIYSVVVLFDLLASEGLYFDTAALILVFITLGNYLEARSKGQASEALRTLLEMEADTATLVADDGTEREVPIED
    VEVGDWMKVRPGEQIPTDGVVVDGQSAVDESMVTGESVPVEKTEGDEVVGATINENGVLVVEATNVGEDTALQQIVQTVK
    EAQSRQPDIQNLADRISAYFVPAVILNALFWGVVWYFFPVTLAEFVGSLPLWGLVGGGPAALSAFEFAVVVFASSVLIAC
    PCALGLATPAATMVGTTIGAQNGVLFKGGDVLERAKDVDTVVFDKTGTLTKGEMSLTDVVAFGDSGTALTDGGSHSPSDL
    ASDGGAITARERPREDEVLRLAAAAESGSEHPLARAIVEGAQERGLAVPDATSFENVPGQGVRATVEGTDVLVGNRKLLR
    DAGIDPEPAAETMERLESEGKTAMLVARVRGSERSANRDASAETPRAGELLGVVADADTVKESAKDAVSTLRDRGAEVMM
    ITGDNSRTARAVAEQVGIDPENVRAEVLPEDKSDAVEDIQADGRKAMMVGDGVNDAPALAVAYVGCAIGSGTDVAIEAAD
    VTLMRDDPLDIVKAIRISEGTLAKIKQNLFWALGYNTAMIPLASIGLLQPVLAAGAMAFSSVSVLTNSLLFRQYTPDHDY
    ELFGRFRR

    >gi|313117001|ref|YP_004038125.1| Zn-dependent hydrolase, glyoxylase [Halogeometricum borinquense DSM 11551]
    MEGTQSETENSVESITPEQLNAQISDGDGAFILDVRSADNFDEWHIEGPNVESLNYPYFELLDGIPDDLLAQLPEDRTIT
    VL
    CAKGGSSEMIAESIQEEGFDVNHLERGMKGWARIYEYDELDVDVAATVAQYRRPSSGCLAYLVASDGEAAVIDPLRAF
    TDEYVQDARALGTDLTYALDTHVHADHISGIRTLSEQTDATAVLPAPAVARGVEYDVPFEQVADGDTLSVGNVDIEVIHT
    PGHTSGMTAYKVGDVLFTGDGLFTESVARPDLEDPEAATDAARTLYTSLTEKVLPLPDETVVAPAHFSDAATPNDDATYT
    AELGTLTETMDALAMDEDEFIEFIVADMPPRPANYEEIIATNLGLESLDDEKAFELELGPNNCAASNGALTN

    >gi|313122493|ref|YP_004038380.1| methionine-S-sulfoxide reductase [Halogeometricum borinquense DSM 11551]
    MSDTERATLGGGCFWCLEAPMKELVGVESVTSGYAGGHVENPTYEEVCEGTTGHAEVIQVEFDPEEISFAELLEVFFAIH
    DPTTEDRQGPDVGSQYRSAVFYHTEAQRETVESLIDEMNESGVYDDDIVTEVAPLDTFYEAEEYHQDYYEKNPDQPYCAV
    QIPPKLEKVREKFEGKVRGVN

    >gi|313117295|ref|YP_004044278.1| copper/silver-translocating P-type ATPase [Halogeometricum borinquense DSM 11551]
    MISDVSTDSPVVRSESPDAESDACSLCELPTPAEPFTADDVDGAYCCRGCLEVSRALGGPERAAESDIEQSLAAATDADD
    VPAATDADDVPDDAARTFLSVDGMH
    CATCETFIESTAVGDDGVYAAEASYATDMLRVTYDPDETDLDGLVGRLGRYGYDA
    TDPDAAAETDEGSGLAKFLIGGGVFGMMVMVWYVLFLYPTYLGFDPVVDLGAFDGLYVVANVWVMSSIVLFYTGYPILRG
    AYVSLAARQPNMDLLVALAAVAAYVFSVGSMVVGRTHVYFDVSVAIVLVVTLGNYYEDRIKRRAATRLTDLTSARVTDAT
    RLSDDGRTESVPVESIRPDDRILVRPGERVPVDGVVVEGRAAVDESLVTGESIPTTREPGDSVIGGSVVTDDALTVEVGD
    DATSTLDRLVELLWEIQSSRGGAQRLADKLATVFVPLVLALSVLTTAGFLVLGSSPTDALLNGLTVLIVSCPCALGLATP
    LAVASGVRDAADSGVVVASDAVFEDAPDADTIIFDKTGTLTDGRMRVRGVTTAAADETTALELAAAVERYASHPLAEALV
    QCAPDRLPTVTDSTVHQRGVTGRVDGTDIVVGHPSLLREAGVTVPDELASAGESVRDAGRVPVFVGWDRSARAVFDVGDA
    PREMWDETLSELGAERELVVLTGDDERAAAQFRSHPAVDEVFAGVPPEAKAETVERFRSRGTVAMVGDGSNDAPALAAAD
    VGIAFGSGTDLAGSAADAIIVERGLDTVPTVFSVAAGTHRRIRENLAWAFVYNLVAIPLAISGLINPLLAAVAMGTSSLL
    VVVNSARSVE

    >gi|313117434|ref|YP_004044417.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Halogeometricum borinquense DSM 11551]
    MSDFDVIVVGGGSGNNVAAAAADAGLDTALVEPGPLGGTCLNRGCNPSKMLIQAANAANSVRDAAKFHVDATVNEIDQAA
    VIDEMDDLLGGIAEDMEARYREKEHLTLFKEYTEFVDERTLKLDGDAVTAEKVVVATGSRPIVPPIDGLDNIDYLTSQEA
    LNLRETPESLVILGGGYIAVELGYALQSMGTDVTIVEMLDSLVPREDGDIAAAFTKVAAERHDVYTGHRVTAVEEHSEGY
    AVHAETEAGDKLTVEGSEVLVALGRQPNSDDLGLDAAGIEVTERGFIETNEYLETTAENVWAQGDVAGNALFKHSGDYET
    RHTVSNVVHGEHRAIDLSAMPHTIFTEPQIAGVGATEEDLQEEGTEYVVGRAAFAESAMGRAKKLEDGFMKVLAAPDGEI
    LGSHAIGYEASTLLHEAVIAMRHGLSVADVAETIHAHPTLSKVVEAAFRDVPN

    >gi|313122732|ref|YP_004044659.1| dihydrolipoamide dehydrogenase [Halogeometricum borinquense DSM 11551]
    MGAKETTTETDVLVIGAGPGGYVAAIRAAQHGLDVTLVEKEAYGGVCLNHGCIPSKAYISATDLAHDAGQAAEMGILVDP
    AIDMAKMQEWKSNSISRLTDTVEKLCKANGVSLIEGMASFVDETEVHVTRDEDNRDRVSIGFERCIISTGSRPVQIPGFD
    FTDDEVWSSRDALSAATVPDRLVVVGAGYIGMELSTVFAKLGSDVTVIEMLDDALPGYEDDITRVVRKRASELGIDFRFG
    EGASEWRGIDNGIEVVTETEDGERSVYPTDKVLVAVGRQPVTETLDLEQIGLEPTEQGFLETDRHARTDVEHVFAVGDVA
    GEPMLAHTASKEGIVAADVAAGKPSTMDNRTIPAAVFTDPEIGTVGLTAAEAESEGFDPIVGTFPFRASSRALTTGETEG
    FVRIVADGECGTVLGAQIVGAEASELVAEVALAIELDATVEELASTVHTHPTLAEAVMEAAENARDRAIHTLNR

    >gi|313117002|ref|YP_004038126.1| predicted transporter component [Halogeometricum borinquense DSM 11551]
    MSELVPLVVVGDLFPRGIWPYLLGGLLVGLGASGIYLSTGLIAGASTFLESTLSYVSDVPRFNRSKYVQSRRWRVVFTAG
    IVSGAAVYGLVLDPGLWTTDVQWWRLLGGGFLVGVGTRLGKG
    CTSGHGVCGLGSLSNTSVVNVLTFLAFAIGTAQLVAAL
    GVSP