Halobacterium salinarum R1

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|169235125|ref|YP_001688325.1| molybdenum cofactor biosynthesis protein moeB [Halobacterium salinarum R1]
    MSGLELDATQLDRYSRHIIMDDVGATGQAALREAAVLVVGAGGLGSPVIQYLAAAGVGTIGIADDDAVELSNLQRQTIHG
    TDDVGEQKVDSAAAFVDTLNPDVDVQRHDQRVTADTVTDLIAAYDVVVDASDNFRTRYLINDACTLAGVPFSHGAIFQFE
    GQVTTFTGGDDGPCYRCLFPEAPPAGTVPD
    CATAGVLGVLPGTIGSIQATETVKHILGVGDSLDGRLLFYDAADMSFETV
    ALAQRPECPICGDSPVVDSVQEVAYTESCAVTGDATTE

    >gi|169235179|ref|YP_001688379.1| cadmium-transporting ATPase [Halobacterium salinarum R1]
    MDCSSCAGSVADALDATAGVTAHEEQPTTGSVVVTLDESTATTPDVVAAVEAAGYDVTGTDGDRDTSRADVWTSPRALQT
    AVGGVFLLAGLALRFFVGDANVVLGVVAGTSLHAADVAFLVAVAAGGFKTLRNGARSARDRRMDIDFLMSIAILGALTAS
    FAFGKPLYFEAATLAVLFSIAELLEGYAMDRARQSLRELMALSPDEATIIDPDGTETTVPADTVSIGDRVAVRPGEKIPA
    DGVVVDGDSAVDQSPVTGESVPESKQPGDEVYAGTVNETGYLEVEVTAAPGDDTLSRIVELVEDAQSNQTDREQFVERFA
    AKYTPAVVALAVLTTLGSPFVLGVSWPTAVVHGLTLLVLACPCAFVISTPVSVVSAITSAANHGVLVKGGTHLEAMADVD
    VVAFDKTGTLTAGDLAVTDVRGLNGHRERDVLACARGLEARSEHPIADAIVDAADEAGVDAPSVTDFDSVTGQGVRATLD
    GQPHFAGKPALFEEHGVDLSHVHATTDGGLRAAQPDCEHADCLDLRADTIPDLQAAGKTVVLVGTADALLGVIAVGDTVR
    AGAADTVSRLREHGVARTVMLTGDNERTARAVGDEVGVDAVYADCLPAEKASVVADLQDEHGDVAMVGDGINDAPALAAA
    TVGIAMGAAGTDTAIETADVALLGDAITTLPYLYELAGDTNTVIRQNIWASLGLKAALAVGVPFGLVPIWLAVLAGDAGM
    TLGVTGNALRLGRISP

    >gi|169235181|ref|YP_001688381.1| thioredoxin [Halobacterium salinarum R1]
    MNRRRVLAALAGSGLTGASVWVARNGVPSPGDEDAASGGLPRTVETLDAPGSTAGTAQVPSPDAPTVVDLFATWCARCDE
    QLASMRAVRGDYPDVSFVSVTNERVGDTLTRGDLADWWTANGGEWTLGVDPGSGVLAAFGANALPFVAITDADGEIVATH
    SGVASAATLRERLDTVT

    >gi|169235184|ref|YP_001688384.1| putative oxidoreductase (mercury(II) reductase homolog / dihydrolipoamide dehydrogenase homolog) [Halobacterium salinarum R1]
    MTTEQPHVVIVGAYGSAGVAAAEELVDEDVTLTLIDDGEPGGGLCILRGCMPSKEVLSAGAHRYQARHDDRLTGAVPDVD
    LDAVVDTKDDHVLGFAEHRRAAVHDMAEREHVTFHHDTARFVDDRTLVVDGERIEADYVVLGTGSALNVPDLPGIADTDW
    MGSRDVLDATEFPDSGVVMGFGYVGVELVPYLSEAADMDLTVIEHDDRPLDSFHPVFGEEILAQYREEFDVDIRTEVREE
    AVEETDDGGVRVRLDDGTTAEGEQLFLFTGRTPSYPAGIEETRLTPDPEWVDPATMQARDDDHVFVVGDAMGERMLLHNA
    KEEGYAAGRNALAVERGGDLETYDPFSHQVMFSGLGVFPFASLGLTAEAARAAGHDVVTSQRDASSDGVFKTKDAARGAA
    RLVVDADDGTVLGYHGLHYHADVMAKTMQVVLAAGMDVREIPDRAYHPTTPEVLDGLFGDAAAEL

    >gi|169235196|ref|YP_001688396.1| thioredoxin [Halobacterium salinarum R1]
    MTVQHRRPDRVADSDDLDAAIAGADRVLVLFYTTGCSLCQAIEPVVGNVARDTGVPVVMVNPGDDIGLVDEWAIRSVPTL
    VLVEGGTEVGRLADGFQGGDAIEAFIADHA

    >gi|169235198|ref|YP_001688398.1| DSBA thioredoxin domain-containing protein [Halobacterium salinarum R1]
    MFFCCAVVRSGVTGSITVYSDYVCPFCYLGRQSLETYREARDDAAPALEIDWQPFDLRSRQRRPDGTLDESVDSGKDEAY
    YEEARQNVERLREEYGADEMSTDLVGDVDGFRAQVASLYVKETFPEQWLAFDEGVFAALWADDRDVGDADVLADIADGVG
    LDGEEIRTVVDDEAWRDRLRDEFADAREAGITGVPTFVYDGHGARGAVPPSQLERLVEGV

    >gi|169235403|ref|YP_001688603.1| putative glutaredoxin [Halobacterium salinarum R1]
    MAFDPLDSSMAQDAVDDIVDAAIENNEVVLFMKGTPAAPQCGFSERAIRLISDYRPDVHTVDVLQSTDEFRAALERHSGW
    ETTPQAFVDGSFVGGSDILAELADRGDLADELNADGVDTTADDAALDADIDAPF

    >gi|169235603|ref|YP_001688803.1| putative copper-transporting ATPase [Halobacterium salinarum R1]
    MTTRTARIDVGGMSCANCSGTVEDAVGALDGVTDATANFATDAATVTYDPTAADLAGVCAAISDAGYTPITADTTIPVHG
    MT
    CANCAQTIEDAVADAPGVLDVSANFATDDAHLTYVPAAFDRDAVHAAITDAGYDPIDADSDTGASTQTAADEARDAER
    RRQRIRLAFGAVLSAPLLFFVADTFLFGGAVVPDSFTVGGLTIPFGWAEFALATPVYVVLGRSFLSNSYAALVRNGTANM
    DVLVALGSTTAYVYSLASLLGVLAGGGLYFDTAALILVFITLGNYLEARSKSQASDALRELLEMEANTARLVDADGETRE
    IPADDVEVGDRLKVKPGEQIPTDGVVVSGESAVDESMVTGESVPVSKAPGDDVVGATINENGVLVVQATKVGADTAIQQI
    VTTVRDAQSRQPDIQRLADRISAYFVPAVIANAVFWGAVWWFAPGLLADVVSALPLWGLVSGGPAAVGTGEFAVVVFASA
    VLIACPCALGLATPAATMIGTSIGAKHGVLFQGGDVLERVTELDAVVFDKTGTLTTGAMELTDVEAVAAVPDGGTATRSD
    AAVDEDAVLRLAAAAESNSEHPLGTAIVAGAEDRGLDVPAVDAFENVPGKGIVATVDGRRVRVGNRALLTSADIDPAPAA
    DAMERLEREGKTAMLVAVDDRVAGVVADADTVKPEAAATVDALQDRGLDVHMITGDNERTARAVAADVGVSPEHVRAGVL
    PGEKADAVDAIQAGDADAMMVGDGVNDAPALATAHVGAAIGSGTDVAIEAADVTLMRDDPADVIQAIRIGEGTLAKIKQN
    LFWALGYNTAMIPLASLGLLQPVLAAGAMAVSSVSVLTNSLLFGRYTPDEDYSLLGR

    >gi|169235851|ref|YP_001689051.1| homolog to glutaredoxin [Halobacterium salinarum R1]
    MRVSTVPIGMSQVTFYAREDCPYSQKVRSKLDALDVAYEETLVPDAHTDRTTVEDVTGQTGVPVVIDDHMEPSFLADTQE
    IITHLETQYA

    >gi|169235874|ref|YP_001689074.1| hypothetical protein OE2515F [Halobacterium salinarum R1]
    MTIEVTSTSADGYTTQSRIGDFELTIDATDEDGPNPNATLLADYASCFIPAFRVGGQKEGFDDLGRIDIDVEGDLDDHDD
    LTAIRFHLLVEEDLDDEAFDAIADRAEDI
    CHVHSALRADLHAELSAETGAF

    >gi|169235982|ref|YP_001689182.1| peptide-methionine (S)-S-oxide reductase [Halobacterium salinarum R1]
    MGTETATLGGGCFWCTEAAMEELAGVTDVTSGYAGGDTADPSYRDVCSGTTGHAEVVQVEYDTAELAYEDVLEVFFTVHD
    PTTVDREGPDVGSQYRSIVLPHDDQQHERATAFVDELAAADAFDGSIVTEIEPLETFYPAAEKHQNYFEKNPDAAYCTVN
    VAPKVSKVREQFGARTE

    >gi|169235996|ref|YP_001689196.1| peroxiredoxin (thioredoxin-dependent hydroperoxide peroxidase) [Halobacterium salinarum R1]
    MLSEGTTAPDFSLANQDDETVSLSSFAGQHVVVYFYPRADTPGCTSEACEFRDNWGRYDDAGVPVVGISDDPVSELAAFK
    DKYNLPFDLLSDAGGEVATAYESYDEQEITGELMDVTLRNTYVIGPDGTITAAFEGVDPEGHADEVLAAIEDAA

    >gi|169236045|ref|YP_001689245.1| thioredoxin-disulfide reductase [Halobacterium salinarum R1]
    MEHRQLVIVGSGIAALSAATYAARSNNDPLLFEGDEPGGQLTLTSEVENYPGFPEGIAGAELIQEMKTQATRFGAEVEHG
    IVESVDDSGRPFRLTLTNGDVYTADAVIVASGASARTLGIPGEDELMGQGVST
    CATCDGAFFRGEDMIVVGGGDAAAEEA
    SFLTKFADTVYLVHRRDELRAEDYWADRIREHVADGDIEVLWNTEAVEVHGSPEEGVTGASLVRHPEGHPTAKLDADETE
    QLELDIGAFFIAIGHTPNTSFLADTGVVCDDAGYVQTVGGAGGGQTKTDVTGVFGAGDVVDYHYQQAVTAAGMGSKAAID
    ADEYLESVADGVTGETADATPADD

    >gi|169236078|ref|YP_001689278.1| hypothetical protein OE2863R [Halobacterium salinarum R1]
    MTHPTARNRLDEAASPYLRQHADNPVNWQPWGEPAFSAAREHDVPIFLSIGYSACHWCHVMAEESFADPEIAAVLNEQFV
    PVKVDREQRPDVDDLYMTVSQVTRGSGGWPLSVFLTPERKPFYITTYVPKEPTRDQPGFESLLEDVTANWRENRGDLDAR
    AEQWLQAARGELESVPDPVDDAGTDSPLPAAAGSIADAADATHGGFGRGQKFPHAGRLRVLLRATQRDAGDGARAASAAR
    HTLTAMADGGLHDHVGGGFHRYCTDREWTVPHFEKMLYDQAALARLYVDGYRALGDSRYADVARSTLTFVDRELGHPDGG
    FYATLDARSPPPDAPDGDREEGAYYVWTPNRVAAAMRDHAAAAPCDTADADVLADAACRRYGVDDTGNFEAGTTVPTVSA
    SVGAIADAFDTAPATAEAWCDVIDARLRAARADRPRPARDEKVLAGWNGLMARAYAEAGLALDDRFAERAADAIAFARDT
    LWDGDRLARRSIGGDVAGVGYAADYAFLAAGALATYEATGAVAHLDFALDLADAMLEACYDASAGVLYETPASVDDVAVR
    SQATGTGSTPSPIGVAADTLDALAAFAPAAGYDDAAAALLSRYGSHIEESPGRHPELVLAADTRAGGRREITVAADDLPD
    AWRDAVGAAYLPDRLLSRRPPTEDGLDAWQSTLDQASVPPLWAGRTGGDDGTPRAYVCRRACSPPLDDAAGITEWLAEFS
    R

    >gi|169236155|ref|YP_001689355.1| hypothetical protein OE3008F [Halobacterium salinarum R1]
    MAPRDTDADDTDWAATLTDDQYRVLREQGTERPFSGDHVDRDEDGTYSCVGCDTTLFDGETKFDAHCGWPSFWDAADDDA
    IERREDHSNGMERTEVVCAECGGHLGHVFQDGPDPTGERY
    CINSVALDFEPTE

    >gi|169236265|ref|YP_001689465.1| putative glutaredoxin [Halobacterium salinarum R1]
    MTLTLYALDGCPDCESVIDTLAADDIDHETVHVDARHSARNAVKRASGQRSVPVLVDDDRGVVMADSQRIQTYAAVTLA

    >gi|169236480|ref|YP_001689680.1| peroxiredoxin-like protein [Halobacterium salinarum R1]
    MRCEGARAPAFELPGVSDGTQTRLGLTDALADNRAVVLFFYPFDFSPVCATELCAIQNARWFDCTPGLAVWGISPDSTYA
    HEAFADEYALTFPLLSDHAGAIADAFGVLQASAEDHDRVPERAVFLIDADRVIRYAWASSDLSESPDLGAVKAAIDDLQP
    DTAGVAPRTISDAHDDGTTDG

    >gi|169236698|ref|YP_001689898.1| putative glutaredoxin [Halobacterium salinarum R1]
    MSLELYKLPGCPYCAKVETKLDELGLDYVEHEVPSSHSDRDAVESVSGQTGVPVLVDPDHDIDGMPESDDIVAHLEQHYA
    E

    >gi|169236777|ref|YP_001689977.1| putative cation-transporting ATPase [Halobacterium salinarum R1]
    MTRDSCTLCGLPTPEPPVTGGDDVDGAFCCRGCMEVARTLEDPAAMDDAGAADSLDTGADTTDVDGEAAFLSVSGMHCAT
    CEAFVEAQATDTEGVRAASASYPTETLKVTYDPETVDREAVRAAVDGLGYSATERDGDAAADDDESEVGRLLVGGFFGMM
    TMLWYVLFLYPAYLDVPSAAQLLDLGGLAGSYLLANVWLMATVVLAYTGYPLFRGAYVSLRAGHPNMDLLVGIAAGAAYV
    FSTATILTGGREVYFDVAIVVVLAVTVGDYYEGRVKRAAAGRLADLTEERVDDATRRRADGATETVAIEELQAGDEVVVG
    TGERIPVDGVVTSGSATVDESLVTGESTPVGATPGDDAVGGAVVTDGRLVVAVGDDAASTLDRVVRVLWDVQSARPGVQR
    LVDRVAAVFVPLVVVLAGVAGGWHLLAGGAAANEALLVGLSVLVVSCPCALGLATPLAVARGVQEALDGGVVVTDVSAFE
    AAPAVDTVVFDKTGTLTTGEMRVRDVVGDDGVLARAAAVEQYADHPVAAAITDDATPAGDIDDFERVPGRGVAGSLAVRP
    DGAAAAADAPRVVAGNRALFDDRGWRVPEAYAERAGDARANGNVPVFVGWDGEARGVVVAGDRPRDEWTDVVSTLDADGR
    DVVVVTGDDPEAAARFRDHDAIAAVFAGVPPEGKTEAVRSLRADGDTVAMVGDGVNDAPALAAADLGVALDHAALAADAA
    DAVVTTEDLGAVPRVFALTDATNGRIRQNLAWAFCYNAIAVPLAVAGVLNPLFAAGAMTVSSLLVVGNSTRSLLDDGVAG
    P

    >gi|169236793|ref|YP_001689993.1| dihydrolipoamide dehydrogenase ( glycine cleavage system protein L and E3 component of branched-chain amino acid dehydrogenase) [Halobacterium salinarum R1]
    MVVGDISTGTDVAVVGAGPGGYVAAIRAGQLGLDVTLVEKDAYGGTCLNYGCIPSKAMITASGVAHEAGHAEEMGVYADP
    DVDVAEMVDWKDGVVDQLTGGVEKLCKANGVNLIEGRAEFAGSDKLRVVHGGDGQGSETIEYEHAIVSTGSRPIEVPGFD
    FGDDPVLDSRQALAMAELPSSMVIVGGGYIGMELSTVFAKLGVDVTVVEMLDGILPQYGDDIARPVRQRAEELGIDFHFG
    LAADSWTDTDDGIVVTAADEDGEETEFETEKVLVAVGRQPVTDTLNLDAVGLEPNDDGRLETDHEARTDVENVFAIGDVA
    PGPMLAHKASKEGEVAAEVIAGEPAALDYQAVPAAVFTDPEIGTVGLTEDDAAAQGFDPVVGTFPFNASGRALTTGHDDG
    FVEVVADEESGFLLGAQIVGPEASELVAELGLAIEMGATLEDVASTIHTHPTLSEATMEAAEHALGHAVHTLNR

    >gi|169236844|ref|YP_001690044.1| hypothetical protein OE4197F [Halobacterium salinarum R1]
    MPHRRRVLTATAAAASLSLAGCLSNDGGGDSQASSSTDAETTGDAASLADHPAAAGLDAQPVLGPDPLSADTTVVVFSDP
    S
    CPHCQDFEADVFPKLNANFIEPGSLSYVYRNMAFVAPWATGAVHAFEETYERNTDAFWALREWVYSNPDQVADDPGDAI
    KSYLASETDIEDPEAVRTAAAERTQSAQVSQDETAAKNAGINSTPGFVVAADGVVTTSFTGAKPYDEFVELAGLSE

    >gi|169236869|ref|YP_001690069.1| putative glutaredoxin [Halobacterium salinarum R1]
    MSAPAAPPRPPHSDAHITLYRLQACPFCERVVNRLEELGLAYQSRYVEPMHSERDAVKRIVGARTVPAIVDDETGVAMAE
    SANIVAYLDATYGGGE

    >gi|169236936|ref|YP_001690136.1| thiosulfate sulfurtransferase [Halobacterium salinarum R1]
    MADYATDVLVTADWVDDHLDQFRSDDPDHRLVEVDVDTEAYEESHAPGAIGFNWETQLQDQTTRDILDKDAFESLLGSHG
    ITEDSTVVLYGDNSNWFAAYAYWQFKYYGHDDVKLLDGGRDYWMDNDYPTSEEPPSFSATDYDASGPFEGIRAYRDDVEN
    AIDKGLPLVDVRSPEEFSGEILAPPGLQETAQRGGHIPGAENISWAATVNADGTFKSADELRSLYADQGIDGDETTVSY
    C
    RIGERSSIAWFALHELLGYDNTVNYDGSWTEWGNLVGAPVETGE

    >gi|169236937|ref|YP_001690137.1| thiosulfate sulfurtransferase [Halobacterium salinarum R1]
    MSDNWVVTPDWLDEQDDASVRVVDVRDAWEYDGIGHVPGAVNVPFDAFRSADGPQGMLPPAGEWAAVLSAAGVERGDTLV
    AYDDTHGVFAARFLVTALYHGHDDVAVLDGDYSAWVREHETTTGTPEVDETTYEPGERGVDVFVGTEAVADAAASDAAVV
    VDTRDPGEFADGHIPDAVNVTWTAFVDDDTRGLKSRAAIEDVLAEHGITREDRVVLY
    CNTARRISHTFVVLRWLGFTDVS
    FYEGSVRAWTAAGRSLV

    >gi|169237082|ref|YP_001690282.1| rhodanese domain-containing protein [Halobacterium salinarum R1]
    MDGELSADDLAAVLDDDALRIVDIRTPPAFARGHIPGSENIPFQELPQRVDQLAGADRVVTVCPHGKSSKQAARLIASYE
    GVSADTQVESLGCGIDGWPGDLEQSSDTAADEGPETDAPF

    >gi|169237096|ref|YP_001690296.1| thioredoxin [Halobacterium salinarum R1]
    MTVTLKDFYADWCGPCKTQDPILEELEADYDEDVSFEKIDVDEAEDVANEYQVRSIPTIVVENDDGVVERFVGVTQREQL
    EDAIESAGA

    >gi|169237208|ref|YP_001690414.1| fused rhodanese domain-containing protein/hydrolase [Halobacterium salinarum R1]
    MNADDFPTPDADVESVDPESLKDRIDAGEDVTLLDARMTSDYEEWHIDGENVTSINVPYFEFLEDDIDEDVLDQIPDDRE
    VTVL
    CAKGGASEFVAGTLAERDYDVDHLEDGMNGWARIYDAVEVEGYDGAGTLLQYQRPSSGCLGYLLYDDGEAAIIDPL
    RAFTDRYLDDADNLGVDLQYALDTHVHADHISGVRNLAEEDIEGVIPEAAVDRGITYADDMTTAADGDTFDVGDATIEAV
    YTPGHTTGMTSYLVDDSLLATGDGLFIESVARPDLEEGDDGAPDAARMLYESLQERVLTLPDDTLVGGAHFSDAADPAAD
    GTYTAPIGELVDEMDALTMDEQAFVDLVLSDMPPRPANYEDIIATNLGQNAVDDEEAFTLELGPNNCAASQDSLAGD

    >gi|169237209|ref|YP_001690415.1| hypothetical protein OE7072F [Halobacterium salinarum R1]
    MVIDPLPLQVAAELFPNGISRYAIGGLLVGLGVTVIYLGTGISAGASTFLESTLSYVSDQSRFQQYVSSRDWRLVFTLGI
    VLGAAVYAVVYQGGAWTTDVQPWRLLVGGVFVGIGTRVGKG
    CTSGHGVCGVGSASKTSIVGVLAFLTVAIVTAQVVAALG
    VSP

    >gi|169237213|ref|YP_001690419.1| fused rhodanese domain-containing protein/hydrolase [Halobacterium salinarum R1]
    MQELSPAELGEQVQDDDGPLVLDIRHEEDFQEWHIPGSRNVDVYDELTDDPEQAIEPLDDLPSDEQIVTVCAAGVVSQTA
    TAVLRELGYDAVTLTDGMNGWSRVHRHAELPVDVDGTLVQVARPGKGCLSHVLVSDGEAAVFDPSHYLNEYDTVLDEYDA
    ELVGVFDTHAHADHVSGAADLADRHDVPYYLHQKDALAVDATPLEDGQTVTVGRLDIEVIHTPGHSEGSVSFDVEGAALL
    TGDTLFHDSVGRVELGVEAGIEDADVEGNAATLYESLQRLLDRPDDALVLPAHDPGSPEPPVAATLAEVRERNDDLGRDR
    EAFVEELASDIPDHPPNFERVKRTNVGQESVPEEELAELELGPNNCAAE

    >gi|169237218|ref|YP_001690424.1| thioredoxin [Halobacterium salinarum R1]
    MATDTAATTGTASPDEPLYVNGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASA
    YGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTE

    >gi|169237219|ref|YP_001690425.1| thioredoxin-disulfide reductase nonfunctional N-terminal part) [Halobacterium salinarum R1]
    MTEDSHDLVIAGSGIAGLSAAVYAARADLEPLVLEGDEPGGQLTLTTDVENYLGFPDGVGGMDLVQRGKEQAEQFGAQFE
    HGRIEAADLDGQPLELSLSTGDTLYTRSLIVATGASARWVGAENEDELMGAGLST
    CATCDGAFHRGDDVLVVGGGDSAME
    EALFLAKFADSVTVVHRREELRASEIMADRARDHDDVQFRWNTEL

    >gi|169237599|ref|YP_001690803.1| putative methyltransferase (homolog to phosphatidylethanolamine N-methyltransferase) [Halobacterium salinarum R1]
    MSNDNETMVADRDPEETREMVRERYAGIATSGQDCCGDVGLDVSGDGGCCSDETEASGSERLGYDADDVASVADGADLGL
    GCGNPKAFAAMAPGETVLDLGSGAGFDCFLAAQEVGPDGHVIGVDMTPEMISKARENVAKNDAENVEFRLGEIGHLPVAD
    ESVNVVISNCVVNLAPEKQRVFDDTYRVLRPGGRVAISDVVQTAPFPDDVQMDPDSLTG
    CVAGASTVDDLKAMLDEAGFE
    AVEIAPKDESTEFISDWDADRDLGEYLVSATIEARKPARDD

    >gi|169237712|ref|YP_001690915.1| fused rhodanese domain-containing protein/hydrolase [Halobacterium salinarum R1]
    MNADDFPTPDADVESVDPESLKDRIDAGEDVTLLDARMTSDYEEWHIDGENVTSINVPYFEFLEDDIDEDVLDQIPDDRE
    VTVL
    CAKGGASEFVAGTLAERDYDVDHLEDGMNGWARIYDAVEVEGYDGAGTLLQYQRPSSGCLGYLLYDDGEAAIIDPL
    RAFTDRYLDDADNLGVDLQYALDTHVHADHISGVRNLAEEDIEGVIPEAAVDRGITYADDMTTAADGDTFDVGDATIEAV
    YTPGHTTGMTSYLVDDSLLATGDGLFIESVARPDLEEGDDGAPDAARMLYESLQERVLTLPDDTLVGGAHFSDAADPAAD
    GTYTAPIGELVDEMDALTMDEQAFVDLVLSDMPPRPANYEDIIATNLGQNAVDDEEAFTLELGPNNCAASQDSLAGD

    >gi|169237713|ref|YP_001690916.1| hypothetical protein OE6192F [Halobacterium salinarum R1]
    MVIDPLPLQVAAELFPNGISRYAIGGLLVGLGVTVIYLGTGISAGASTFLESTLSYVSDQSRFQQYVSSRDWRLVFTLGI
    VLGAAVYAVVYQGGAWTTDVQPWRLLVGGVFVGIGTRVGKG
    CTSGHGVCGVGSASKTSIVGVLAFLTVAIVTAQVVAALG
    VSP

    >gi|169237717|ref|YP_001690920.1| fused rhodanese domain-containing protein/hydrolase [Halobacterium salinarum R1]
    MQELSPAELGEQVQDDDGPLVLDIRHEEDFQEWHIPGSRNVDVYDELTDDPEQAIEPLDDLPSDEQIVTVCAAGVVSQTA
    TAVLRELGYDAVTLTDGMNGWSRVHRHAELPVDVDGTLVQVARPGKGCLSHVLVSDGEAAVFDPSHYLNEYDTVLDEYDA
    ELVGVFDTHAHADHVSGAADLADRHDVPYYLHQKDALAVDATPLEDGQTVTVGRLDIEVIHTPGHSEGSVSFDVEGAALL
    TGDTLFHDSVGRVELGVEAGIEDADVEGNAATLYESLQRLLDRPDDALVLPAHDPGSPEPPVAATLAEVRERNDDLGRDR
    EAFVEELASDIPDHPPNFERVKRTNVGQESVPEEELAELELGPNNCAAE

    >gi|169237722|ref|YP_001690925.1| thioredoxin [Halobacterium salinarum R1]
    MATDTAATTGTASPDEPLYVNGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASA
    YGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTE

    >gi|169237723|ref|YP_001690926.1| thioredoxin-disulfide reductase, nonfunctional N-terminal [Halobacterium salinarum R1]
    MTEDSHDLVIAGSGIAGLSAAVYAARADLEPLVLEGDEPGGQLTLTTDVENYLGFPDGVGGMDLVQRGKEQAEQFGAQFE
    HGRIEAADLDGQPLELSLSTGDTLYTRSLIVATGASARWVGAENEDELMGAGLST
    CATCDGAFHRGDDVLVVGGGDSAME
    EALFLAKFADSVTVVHRREELRASEIMADRARDHDDVQFRWNTEL