Haloarcula marismortui ATCC 43049 uid57719

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|55376428|ref|YP_134280.1| hypothetical protein pNG6020 [Haloarcula marismortui ATCC 43049]
    MSDTTQFRVLDFDCPTCASTVERALSNVDGVQHVEVHYATGRVEIEYDDSVADPDAFAETIENQGYTPQPA

    >gi|55376437|ref|YP_134289.1| thioredoxin [Haloarcula marismortui ATCC 43049]
    MTEVILFTQETCGACATQREKNEGIEDAYPDVEFREVDIQTDLETAEEYGVRKTPTTLVYANGEQTAEFIGIVDRDELEA
    AIESAGQQSPGLTNRLASIIRG

    >gi|55376454|ref|YP_134306.1| copper-transporting ATPase [Haloarcula marismortui ATCC 43049]
    MTSQTIHLDITGMSCANCSATIQDTLESLDGVSEADANFATDEGSVTYDPEEVSLKEIYDAIDEAGYGAVSETVTIAISD
    MT
    CANCAETNQTALENIPGVVNAEVNYATDEAQVTYNPAEVSIGALYDAIEEAGYSPVREDGADEESGQDARDAARQAET
    RKQLRLTLFGAVLSAPLLFFLIDNYLLGGAIVPEAVFGVELGWVEFLLATPVQAILGWPFYKNSYKAIVKNGRANMDVLI
    AIGSTTAYLYSVAVLAELIAGGLYFDTAALILVFITLGNYLEARSKGQAGEALRKLLEMEAETATIVREDGSEEEVPLEE
    VTTGDRMKIRPGEKIPTDGVVVDGQSAVDESMVTGESVPVEKEEGDEVVGSTINENGVLVVEATKVGEDTALQQIVQTVK
    EAQSRQPDIQNLADRISAYFVPAVIANALLWGVVWFLFPEALAGFVDWLPLWGQVAGGPAPVGGTVSVFEFAIIVFASSI
    LIACPCALGLATPAATMVGTTIGAQNGVLFKGGDILERAKDVDTVVFDKTGTLTEGEMELTDVVVFDSDGNVVTDGGEPT
    PDGGQLSTRERLSEDDVLRLAAIAESGSEHPLARAIVEGAEERGLDVTEPDDFENVPGHGIKAVIGDSEVLVGNRKLLRD
    NGIDPSPAEETMERLENEGKTAMLVAYEGELVGVVADADTVKESSKQAVTALQERGVDVMMITGDNERTARAVAKQVGID
    PKNVRAGVLPEDKSNAVDSIQDEGRQAMMVGDGVNDAPALAVAHVGTAIGSGTDVAIEAADVTLMRDDPLDVVKAIRISD
    ATLQKIKQNLVWALGYNTAMIPLASLGLLQPVLAAAAMAFSSVSVLTNSLLFRRYTPDHDYKLFGFLR

    >gi|55376461|ref|YP_134313.1| putative cation binding protein [Haloarcula marismortui ATCC 43049]
    MYLCMTTTITVEGMSCGHCEQTVEEALEEVSGVTDVTVDRESEQASVDGEANVTALVEAVEDAGYTAYA

    >gi|55376465|ref|YP_134317.1| copper-transporting ATPase CopA [Haloarcula marismortui ATCC 43049]
    MDPTDDPMRESGAGAGERDADTPRLGSEERAFFQVDGMHCATCEAFLESVAEDCEGVVDVAASYVTETVRITYDPDRVSK
    ETLCDTLSTLGYSATLRAGGSDDTPTIIGQSRRSDEPNERGIDEVLGFRYAAGVIFGTFMLLPYAVLLYPAQLSSFFGEG
    TLDMYASTSGIGGGDGLLILPLFLVLTGVVLVFTGLPLLQGAYVSLKMRQPNTDFLVAITVVSAYVYSTIAFLLGRLDVF
    YDLTIVVAASVVAAIFYESLSKQRAMDRLTNLTISHVTEARRYGADGTTMVDVHSLEPGERVLVREGERIPVDGVLAESE
    CTVDEAIVTGESLPVSKQAGDEVVGGAVVTNGAAVLTVSDGTTSSIDRLVTSVWNLQSGDHGVQRQADKLASVIIPVVVG
    GAVLAGLGSLLVGTGIPVAVLTALVVLLVGCPWALGLATPLSVATSIEQAVERGIVIFDETVFERLRNVDVVVFDKTGTL
    TTGQMDVLEVDAPSDLLETVAALEQRASHPAADAIVNTFAQRNQEGDRSRADGGVADGSDHEYAADITEFTSHATGVEGV
    VEDTRVLVGNLDLFAELGWSVSEQIETRAAEARTAGHLPVVVGRDGHAEGVVVVGDEPRAGWDDTLTQLNDRDIEIVVLT
    GDDEAATDFLDSHPAVDHVFAGVPPAGKTATIRRLQSRGQVTMVGDGTNDAPALATADLGISLGGGTALASDAADISIVD
    DDLAAVETTFDLADAARRRVKQNNGLALLYNGVTMPLAATGLLNPVFAMGAVVATGGLLAANSFRDLLHE

    >gi|55376475|ref|YP_134327.1| DSBA-like thioredoxin [Haloarcula marismortui ATCC 43049]
    MTAHTCPICTDQFETAGAARDHTWNVHSACHYCGEQLGDETDEQLYRHWLVAHPDDLSGVDYKRAETAVDSLTFSERLSE
    GGVGAAVGGLTRRQLLLGGGGAATAGLVIGATALSNNTSTEPDDGATAGGDTGAVTTAPIPDSPGDFRYATMGSADADVM
    VTYFGSWK
    CPYCAQFSTEMLSQLVTDYVEPGTIALEFRNLAYIGGDPFLGPDAPAAGQAGLAVWNTDPASYWAFHEYVFG
    NQPPESDQWATAERLVEFAQAAGVSETASVRTAIQENQYDDALRATDRAASDVGVDATPTLLIDGMTVNPLGNEERVRQL
    IEDAAGSN

    >gi|55376485|ref|YP_134337.1| zinc-transporting ATPase [Haloarcula marismortui ATCC 43049]
    MTSPDDDSHNRSGEPPDRAHEHEEGSHEHSHTHDHDHSDHEHAQHTEQGVDDVSPPIDQGDVAQFAVPEMDCPSCAGKVE
    NSVEKLDGIRSVDPQVTKGTLTVSYDGEQTSATAIANRVEKAGYTVEDTGEVSSKFTVPEMD
    CPSCAGKIENALERVEGI
    TTFETQPTTGTVVVTYDSSRTGEADIIGAIERAGYKVTDTSSDESGRQDPTEERESIWTSPRALKTWISGGFVALGLLFE
    FFLTGQNVQLASLLGTELLVADVLFLVAVASGGQEIFRNGYYSARNLNLDIDFLMSVAILGALVASLAFGEALYFEAATL
    AFLFSIAELLERYSMDRARNSLRELMDLSPDEATVKRDDTTETVPVDEVAVGDVVVVKPGEKIPMDGTVVDGESAVNQAP
    ITGESVPVDKTMGDEVYAGTINEEGYLEVEVTSEAGDNTLSRIVEMVEDAQSNKTEREQFVERFSTYYTPVVVAFAILTT
    VGSPYVLGTTWPTAVVYGLTLLVLACPCAFVISTPVSVVSGITSAAKNGVLIKGGNHLEAMGAVDVVAFDKTGTLTKGEL
    TVTDVVPLNENSEEDVLRCARGLEQRSEHPIGEAIVAEAGSMGVAEREIDDFESITGKGVRADLDGTPHFAGKPGLFEEL
    GFDLSHVHATTDGGVVTQTARQICDRNNCLDLLDETVPELQAEGKTVVLVGTEDELEGVIAVADEIRPEAKRTVTRLKQL
    GVSRTVMLTGDNERTARAIAEQVGVDEYQAELLPEDKVTAIEELVEEYDGVAMVGDGINDAPALATATVGVAMGAAGTDT
    ALETADIALMGDDLAKLPYLYELAHDANGVIRQNIWSSLAVKAGLAVAVPFGYVPIWLAVLAGDAGMTTAVTGNAMRLSR
    ITPETDTETSASEG

    >gi|55376530|ref|YP_134382.1| cation-transporting ATPase [Haloarcula marismortui ATCC 43049]
    MTENSDVDTAGPPNGGGQRELTARLTVPEMDCPSCAQKVDKSLQRVDGVVEATLQPTTGTATIKYDPDRTTKADVVAAIE
    AAGYDVIGGADDETDESADGVDIAPPSEVWTSSRAKKTWLGAAFVILGLVFEFLLTGQNVAIASILDYPLHIADVLFLGA
    VAASGIPVVRSGYYSAKNRSLDIDLLMGTAIIAATGIGYFVEAATLAVLFSIAELLEDYAMDRARDSLRELMELSPDEAT
    VRRDGEEVTVSVEEVDVGETVVVRPGDKIPLDGTVIEGESAVDQSPITGESVPVDKTTGDEVYAGAINEEGYLEVEVTST
    AGDSTLSRIIEMVQGAQAKKTESEQFVDSFSGYYTPLVVVLAILTAAIPPLVIADPVAVDLAGYGFTFAGDWQTWFIRGL
    TLLVIACPCAFVISTPVSVVSGITSAAKNGVLIKGGNYLEAMGEVDAVAVDKTGTLTKGELAVTDVVPVGDTTEDDLLRR
    AAGLEQRSEHPIATAILARAEEAGVGNLPDPTGFESLTGKGIRGEIGGETYYAGKPALFEELGFDLARARRETDGGVMTE
    EATEGENGAFAEDALSALEREGKTVVIVGTESKLLGAIAIADEVRPASKRAVERLHELGVERVVMLTGDNEGTARAIAEQ
    VGVDEYRAELLPDEKVDAVEELQAEYGDVAMVGDGINDAPALATAEVGIAMGAAGTDTALETADIALMGDDVGKLPYLYD
    LSHTANGVIRQNIWASLGVKFLLALGVPLGLVSVALAVVVGDMGMSLGVTGNAMRLSRIEPDRFSDT

    >gi|55376546|ref|YP_134398.1| monooxygenase [Haloarcula marismortui ATCC 43049]
    MINEGASAPSFTLPGFRDGEQTGYCLDETTANDRAALLVFYPFDFSPVCTNELCAIRDAEWFQLTPALDVWAVSGDSVYA
    HRAFAEEYGLNFPLLSDSSGRVAESYDICYDEWENHERVPQRAVFLIDSQQTIRYAWATEDALEKPDFFPVKDALETLEA
    ERDELGPEDVELVVEYNEEPESLT

    >gi|55376548|ref|YP_134400.1| mercuric reductase [Haloarcula marismortui ATCC 43049]
    MTHTSDYDLVILGGGAAAFAAITEASRRDLSTAMVNTGLPIGGTCVNVGCVPSKHLLAVAESGAAASENPFDAVRYPEEP
    TVDWAAALNDTDELVERFRQENYVDIAEHFEIDIYEGYGQLVDDTTIEVVDGADEGARITGEKALVATGSSPWAPPIDGL
    YDVDYYTSETILEERDLPESILMLGGGYIALEWGQILHRVGIDVTVLQRSDRVLSDMEGQLGREMQRAFEEEGIEVITGN
    DFQRVRTLAADGGAEAIQSGVAVETTIDGDERTVTGDALFVATGVQPNSEGIGLETVGIETNPDGTIRVDEYFQTTNPDI
    YAAGDVIGEPELETVAAKEGNHAVKNAFGNEGVSIDYDAVPAVVFTSPEVAAVGTTELEYMDEHGTCSCRTVQMADVPRA
    KAVENTDGLVQVVKHHETDEIVGVHMVGPRAADMIMEATLAVTFGLTVDDIIDTVHPFPTFSEAFKQACQAFRRDISMMS
    C
    CIE

    >gi|55376552|ref|YP_134404.1| copper-transporting ATPase CopA [Haloarcula marismortui ATCC 43049]
    MGTTHEQFNVGGMSCSFCAESIKKAYSRTDGVEDVDVSLAHEEVLVEYDDERLTGVEVKDTLRDLGYTIRDPDKAKRYEQ
    QQAELADGKRRLLFAGGASIVVAALMGWMIVVMGRFESVSLAMDIVTLGLALGTMFGPGRYIKKKAYQSLRRGIFNQHVL
    LEAGAFAGLVGGLLGLFVFPSFPTVHFFAVSVFITTYHILSEYTSLIVRTRASQAVQGLLDLQPDTARRVSDDGGVEEVP
    VDDLDVGDRVRVKPGENIPVDGTVVEGASTVDESVATGESIPEEKSTGDEVIGGSVNETGTLLVEVTATGEDAFLNQVAR
    EIEEARAMKPGIIQLADRVLKYFVPGVLSIAGLSFLFWVVAPLAWGADPNVQRGAFAALAVLVLGYPCALGMATPLALIR
    GGGKAADRGILMRSGDAFQIFPDVDHIVLDKTGTITVGEPAVSEVVAFGADEVDVLTTAASAEAFSEHPLADAILEFADE
    QDVEYADPDDFDSVTGKGVRATVASDDVLVGKPGWLSDEGIDLSKGSDDIERLQGHGLTVAGVVRDGDLLGLIGIGDEVK
    SDAAATIQRMRDAGITPVMITGDNERTADAVAEEVSIDRVMADVLPDEKREEIGRLQDEGHRVAMVGDGINDAPALTQAD
    IGIAIGAGTDIAIESADIVLMGDRLGGVMDAYEIGNESYRKTRQNLATAFAFNGVGVAAATTGLVHPVFAMLAMVLSVSA
    VLANSFAGQLLSGEGVNTEFALDDRTDGERGDGRVTAD

    >gi|55376553|ref|YP_134405.1| hypothetical protein pNG6162 [Haloarcula marismortui ATCC 43049]
    MSTSNRDETDTTVTVMVIPRECLQARMERKTISVTGMSCNGCEQNVETALRNLDDVNRIEADHEADTVDVVLEDGVSDDD
    VNAAIEQAGYDVVA

    >gi|55376631|ref|YP_134482.1| hypothetical protein pNG7058 [Haloarcula marismortui ATCC 43049]
    MTGLGLTGGSLWVAQNGLSGIRSQNTDQLPVRVETLDARGSSAGETPVPTPGTVTVVDLFATWCAPCDDQLEILDSIRPE
    YTDVSFISVTNERPSETLTRADIGEWWNRNGGAWTVGIDPGSELLAAFGADGLPYIAIVDERGTVQFGHSGLAGKETLRD
    ELDALV

    >gi|55376650|ref|YP_134501.1| thioredoxin reductase [Haloarcula marismortui ATCC 43049]
    MHRRRSGPTSQPLARGERGLPANRSFASLIAWLTSVRLLCRSPPFCCFYSLSTYTTVMYTDGQYDYDVAVVGGGPAGLTS
    ALYTSRLGMDTIVINRGGGRAAMMTDTHNVIGVTEDVSGNEFLETAREQVQDYGGTYERGFVESVDPLADEEDGFTVTTS
    DGELAVKRVVLATGFADERPDPPLPRTGKGLHW
    CLHCDAFMFVGEPVFVMGTGEAAAHVAMIMLNYTDDVDILTRGETPE
    WSDETQTMLDNHPVEIVETELSGKQTDDDGWLSAYEFEDGSVREYKGGFPMLGSDYHAELADELGLDRNDDGTVAVDDHG
    ETSVSGVYAVGDLTPGHNQIPIAMGEGADAGIAIHKDLRKYPRSVDDIESEGAVEDVEVPAVSEELFATALTHEGHAAGP
    RSEEAPEVRADDD

    >gi|55376655|ref|YP_134506.1| heavy-metal-associated protein [Haloarcula marismortui ATCC 43049]
    MSTALTVEGMSCGHCEQTVEEAIEALDGVKDAEADRDAEQVSVDGDVSTEQLIAAVEDAGYDART

    >gi|55376700|ref|YP_134551.1| thioredoxin [Haloarcula marismortui ATCC 43049]
    MATDTASDAGTTTTNEPLHIDGADQLDDVVNKYDLVLTDFYADWCGPCQMLEPVVETLAAETDAAVAKVDVDANQQLAQS
    YGVRGVPTLILFAGGEQVEEVVGVKGEDDLRALIESYAE

    >gi|55376701|ref|YP_134552.1| NADH oxidase [Haloarcula marismortui ATCC 43049]
    MTDPFVVIGGDAAGLSAASKFAREAPDRDVIVFEKGKWVSYAHCGTPYYVKGTVERLTDLLSLSPEQAAERGIDLRRNHE
    VVGVDTDAETVAVAHDSETFSQPYGDLLVATGARAMTGPIPGTELDGAFTMHGLDSAASVRAALSEPGEFAVDTSIEYVD
    TALVEKYTDWEPPERVAIVGGGYVGVEMAEAFQAHNIETHLFQRSGHLLPPFGEAVGERVARQLREQGVILHLDTAVEEI
    VGNRDERVTAVAHDGGTTDVDLALVGIGIRPNTALLADTPVDLGYSGAIAVDEYGATSVNRVYAAGDCAEDRHAVTGEPD
    WVPLGLTANRAGRAIGQTVAGDPSLVGDIAGTAVVKAFDLECGRVGLLDHEQASAAGFDPVSTTVTAGSRSGYYPGGDDT
    DVTLVADRNSGRLLGGALVGEDRAAIRIDTLATAIEADMTIDELERLDLAYAPPFSPVWDPVLVAAKVLNGQLE

    >gi|55376799|ref|YP_134650.1| intracellular sulfur reduction protein [Haloarcula marismortui ATCC 43049]
    MAYIGFLLTGGPFDSERWRTAYELGRAALDQGHEVSYFHYLDGALVPVADQTLPGCSDSGLYDEMPTEKFQELIADGAEV
    IC
    CGLCVDARGIDAPADYPEGVEVGLLPDLADIIGEADRVVSL

    >gi|55376984|ref|YP_134834.1| hypothetical protein rrnAC0046 [Haloarcula marismortui ATCC 43049]
    MSHVEIEYCVPCGFRERAVHVQQAILSGLERELDSVRLVMGDHGVFRVSVDDETVYDKAEAADELNADAIVREIRSHVR

    >gi|55377038|ref|YP_134888.1| glutaredoxin-like [Haloarcula marismortui ATCC 43049]
    MSLTLYQLDGCPYCEKVADRLDELGIEYDSVWVEALHSKRDEVKRVSGQRGVPVLVDDDRGVTMAESDRILELIETTYAP
    EAQSA

    >gi|55377040|ref|YP_134890.1| peptide methionine sulfoxide reductase msrB [Haloarcula marismortui ATCC 43049]
    MSESEEELPDNDEEWREILSDEEYRILRESGTEPRFSSDLIDVEDEGVFTCAGCGTELFDSDRKFESETGWPSFWDVYQE
    GNVETRADNSHGMERTEVVCAECGGHLGHVFDDGPEPSGKRY
    CINGAALDFESE

    >gi|55377186|ref|YP_135036.1| putative HesB-like protein [Haloarcula marismortui ATCC 43049]
    MSSTADDGDPNLGGEDVAVTEQAAGEALDLLESEGMDVEESGLRLYVQQGGCAGLSYGMRFEHAPEEDDEVFERNGLRVF
    VDDASIDYIEGSVLDYEGGLQGAGFHVKNPNVVSECGCGESFRT

    >gi|55377209|ref|YP_135059.1| zinc-transporting ATPase [Haloarcula marismortui ATCC 43049]
    MTESDGCSDGGACGGASADGPPTATHSHDGPHVAQLSVPEMDCPSCAGKVESSVRELSGIKAVDPQVTTGRLTVEYDETE
    TDVDAIAARVEAAGYTVPDDGGETLRFSVPEMD
    CASCAGKVESALGGVDGIRSAETRPTTGTVVVTYDRDATTEGDLVAA
    IESAGYEVTETTGEDDTGTRQPDENGSLWTSSRALKTWASGVFVAFGLLFEFLLRGANAQVGSVLGSPLHVADILFLIAV
    ATGGQEILRGGYYSLKNRNLDIDLLMSIAILGALTASLAFGEALYFEAATLAFLFSIAELLERYSMDRARNSLAELMDLS
    PDEATVKRDGAEEVLPVDDVQVGDVVVIRPGEKIPMDGEVIDGTSAVNQAPITGESVPVDKTEGDEVYAGTINEEGYLEV
    QVTAAASDNTLSRIVQMVEDAQSNKTEREQFVERFSAYYTPVVVAFAVLVTLSSPAVFGVAWSTAVVHGLTLLVLACPCA
    FVISTPVSVVSGITSAAKNGVLIKGGNHLEAMGDVDVVAFDKTGTLTKGELTVTDVVPLNGNTEQGVLQCARGLEQRSEH
    PIGEAIVAEAGTAGVESADVDDFESITGKGVRADLDGTPHYAGKPGLFEELGFDLSHVHATTDGGVVTKTAQQLCERNNC
    LDLLEDAVPELQAEGKTVVIVGTDEEIEGIIAVADEVRPAAKATVSRLRDLGVERTVMLTGDNERTAGAIAREVGIDDYQ
    AELLPDEKVAAIDDLVAEYENVAMVGDGINDAPALASATVGVAMGAAGTDTALETADIALMSDDLSRLPYLYELANDANG
    VIRQNIWASLAVKAGLALAVPFSVVPIWAAVLAGDAGMTTAVTGNALRLSRVRSESGDG

    >gi|55377252|ref|YP_135102.1| hypothetical protein rrnAC0349 [Haloarcula marismortui ATCC 43049]
    MADIEVESTCEEGYTVESIINGEWELIVDALSENGPSPNEILAADYASCYIPALRVAADKYGHEDIGSVDVEVAAGLDED
    DDLEYIDFHVEVEASLADEEQDIVELAEDI
    CHVHSALQDELHAEITIESGV

    >gi|55377382|ref|YP_135232.1| copper-transporting ATPase CopA [Haloarcula marismortui ATCC 43049]
    MSNRTTRLELTGMSCANCAGTIEESVGELDGVSSVGANYATDGGSVEYDPDVVSLADIVAAVEDAGYGVATETVTVGITD
    MS
    CANCADANEEALEGTAGVIDASVNYATDEAQVTYNPADVSRADLYNAIESAGYTPVREDSGSANGDGDDGEQSGADRR
    AAARNEETRRQLRLTLFGAVLSAPLLLFMADHLFSLGLVGETVLGVPQGWVAFALATPVQILLGKPFYENSYKALVNNGR
    ANMDVLIALGSSTAYVYSVAALAGLIASTGLYFDTAALILVFITLGNYLEARSKSQAGAAIQQLLEMEADTATVVREDGS
    EEEIPIDEVGVGDRLKVRPGEKIPTDGVVVDGDSAVDESMVTGESVPVEKGEGDEVIGSTVNQNGVLKVEATKIGSETAI
    QQIAERVRQAQSRQPDIQNVADRISAYFVPAVIGNAVLWAVLWAVAPETLAAVVDALPLWGLAAGGPPGVGVSEFAIVVF
    ASAVLIACPCALGLATPAATMVGTAIGARNGVLFKGGDVLERVHEVDTVVFDKTGTLTKGEMELTDVEVVGPATDGGALK
    PERERTEAFVLEVAASAEHASEHPLAEAIVDGARERGIEVDDPDEFENVPGQGVKATTRHGRVLVGNRKLLSEAGVDTAP
    AEERMDALEREGKTAMLVALAEDADDDDSDPDYRLIGIVADADTVKESAKAAVSGLRERGLGVWLITGDNGRTARAVAEE
    VGIDPDNVMADVLPEDKADAVDDLQSDGGQAMMVGDGVNDAPALAAASVGCAIGSGTDVAIEAGDVTLLRDDPADVMKAI
    RISEATLQKIKQNLFWALGYNTVMIPLASLGLLQPVLAAAAMAASSVSVLANSLAFRRYTPDSAYRLLGSLRR

    >gi|55377398|ref|YP_135248.1| peroxiredoxin [Haloarcula marismortui ATCC 43049]
    MVSVGDVAPDFTAPIANGDVDEITLSEALDDGPVVLAFFPGAFTSVCSHEMNSFQDRLDELTEAGATLYGVSIDTPFSQN
    AFRDELGLEFDLVSDSGREIVDSYDISMDFEALGVPNVAKRAVFVIDENQEVTYAWVSDDPGVEPDYDEVIDAAT

    >gi|55377693|ref|YP_135543.1| hypothetical protein rrnAC0856 [Haloarcula marismortui ATCC 43049]
    MTRFTRRGLLAATVGAVGAMAGCAGGSSESESAGETETATPTPAPGQPLSTPVAGDPEADVTVAVYEDYACPHCATYSES
    VYPQVREDYLTDGAIRYEFHDFPIPVDEDASWQAASAARAVQDNVGDGAFFTYSERLFANQNQLGPDTYADLTEGIDIDG
    ETVRAAATGELYRPTVSGDREAGIDRGVQGTPAVYVNNERVEWSEVSYEPVRAAIEAARSDG

    >gi|55377924|ref|YP_135774.1| thioredoxin domain-containing protein [Haloarcula marismortui ATCC 43049]
    MSDATDPTARNRLDEAESPYLRQHADNPVNWQPWDETALEAARERDVPIFLSIGYAACHWCHVMEEESFEDEAIAEQLNE
    NFVPIKVDREERPDLDSVYMSICQQVTGGGGWPLSAWLTPEGEPFYVGTYFPPEEKRGQPGFGDLLQRLSGSWSDPEQRA
    EMENRAQQWTEAIESDLEATPADPEDPAEDIIQTAGTIAHRGADRQDGGWGSGGPKFPQNGRLHALLRAYADGGQEDYLN
    VVEETLDVMADRGLYDHVGGGFHRYATDQQWAVPHFEKMLYDNAEIPRAFLAGYQAIGSERYASVVRETFEFVQRELQHP
    DGGFFSTLDAESAPHSESRSDSEQSSGESPRDDPDGETEEGLFYVWTPEQVHDAVDDETDADIFCDYYGVTEQGNFEGAT
    VLAVRKPVPVLAEEYERSEDEITASLQRALNETFEARKDRPRPARDEKVLAGWNGLMIRALAEGAIVLDDQYADVAADAL
    SFVREHLWDADAGRLNRRYKDDDVAIDGYLEDYAFLGRGALTLFEATGDVEHLAFAMDLGQAITEAFWDDEQGTLFFTPT
    GGESLVARPQELTDQSTPSSTGVAVDLLLSLSHFSEDDRFESVAERVIRTHADRVSSNPLQHASLTLATDTYEQGALEVT
    LVGDQSDYPTEWTETLAEQYIPRRLLAHRPAEKSRFEQWLDTLEVDESPPIWAGRTQVDDRPTVYACRNFACSPPKHDLG
    TALDWGETADDSE

    >gi|55377940|ref|YP_135790.1| thioredoxin reductase [Haloarcula marismortui ATCC 43049]
    MTESVEHRRLIVAGTGAAGLTAAIYAARSNNDPLVLEGDEPGGQLTLTSEVENFPGFPEGLSGPDLINNMKEQAERFGAE
    LEHGIVADIDDSERPFRVELSNGDVYTCDAFIAASGASARTLGVPGEDELMGYGVST
    CATCDGAFFRGEDMLVVGGGDAA
    MEEAHFLTKFADTVYIAHRREEFRAEDYWIDRVQQKVDEGEIEIMRNTELLEMHGSPEDGVDHVTLAQNDEGHPSEKLDA
    DGTETFDFDVGAVFIAIGHTPNTDYLGDTGVELDDTGYIQTHGGTGGDQTATDVDGIFGAGDVVDYHYQQAVTAAGMGCK
    AAIDADEYLEAQAEATAEAESEAAAEADD

    >gi|55377956|ref|YP_135806.1| cation transporting ATPase [Haloarcula marismortui ATCC 43049]
    MTHCTLCDLPVDAPVTDDAVEGTFCCRGCLEVARTLDDPATETRDAADTGPDPDDADGETAFVSVDGMHCATCETFLEAR
    ATDHDAIAAAAASYPTGTMKLTYDADALSESALTDVVAGTGYDASLQATETDDEYELEGRLIVGGFFGMMTMLWYILFLY
    PAYLGVDSSLLLFDPSGQAGDYLLWNMAVMTGVVVGYTGWPLLRGAYVSLRAGRPNMDLLVAMAAVTAFLYSVVAVILGH
    TEVYFDVATVIVMAVSVGDYYQDRVRRRALDRLTEFTTQRADSARRRTDGGHEEVDVGSLSAGDEVVVRSGERIPVDGSV
    LEGTAAVDESLVTGESLAVRKTDGDEVIGGSLVTQGGVVVRVGPDAESTVDRLTNLLWEVQSTRGGVQRLVDRIAAVFVP
    LVVVLAVLATGGHLVTGATLTDAMLTGLAVLVVSCPCALGLATPLATAAGIRRALDGGTVVTGDAVFETATDADVVAFDK
    TGTLTTGEMELLERADDRAMARAAAVEQFADHPVAEAVTAAVSVPDATVSEFEQHPGQGVSATVDGEQVVVGTQALFDDL
    GFDVPADLRTRCERATENGRVPALVGWDGEARDVLVAGDRLRPHWESVVSTLARDRDVVVITGDRPEAAVPFERHDGVDE
    VFAGVPPEAKAEVVERLQSRGTVAMVGDGSNDAPALAAADVGIAMASGTSLAADAADAVVTTDDLRAVPDVFSVTAATRT
    RVRQNLAWAFCYNAVALPLALLGVLNPLFAALAMTASSLLVVGNSTRTLAGTASHGDASVDGPAPPQQPAAAD

    >gi|55378052|ref|YP_135902.1| hypothetical protein rrnAC1254 [Haloarcula marismortui ATCC 43049]
    MVSLDSESDVLGRGDEAPTFELPGADGATYSLSDFADKDALLIVFTCNHCPYAKAKIDELNRLATEYDDLAVVGINANDP
    EEYPDDSFERMQELVERGEIQYDAYLFDESQNVAAAYGARCTPDPFLFRNDNGAFKLAYHGRLDDAPNPDDEPSEREMAT
    HVETLLDGDQITAVEKPSRGCSIKWKPGNEPAYWDV

    >gi|55378099|ref|YP_135949.1| glutaredoxin [Haloarcula marismortui ATCC 43049]
    MMGPHSPRRYAFIADAVSGGMAFEPEELSPEEVTEQVDSVIEDNEVVLFMKGNELMPQCGYSKKALALLQQHRDDIETVD
    VLKATDAYREALERHSGRETIPQTFVDGEFIGGSDILEQLDERGELAQKVGQ

    >gi|55378119|ref|YP_135969.1| putative ferridoxin protein [Haloarcula marismortui ATCC 43049]
    MNTGAFVCSCGGSCDIDLEAVRDGVDDVDVVASSELLCQDGLAGMSQVIEEYDLDQVIATTPEPSCQDRIRGLADEHDLH
    PEASVFVDHRETSAWVHDEAAATDKTARLINAKQAGLREEAPSRTVSKDAGNRVAVVGDPGAARSLTDDADVLFIADGRD
    FADVDGLGDVTMERGRVVDIEGSYGEYELTLEARVTDDCID
    CMDCVREGPDGMVTEFPVDIHPDAPDGEWTNTCPTDAID
    LDGVTRTVEVDQVIYPGGRDDARGGRLGFYTGPVDAGTIAAVESQLGGIEKPQFLDLEMDVCAAGASSQEGCTACVDACP
    HGAVDRPTIDSVEFDEVACENCGACTSSCPTGATQLREPSNRRLAREVEALLEDDTDEGLLSRGDSAGIDTQVIAFVCSE
    YAMDRLRAHGRKAVQSGDLDYPPILPVSVNCTDTVGKAHVMHALAAGADGVAVVGCGGSCLHSGPDPKQELVDRLNQATT
    DLGLGDRVGFFAPEAGNPEAFVGSLSGFVEFGLDETPIPAGGYEATGRSDADREDPRPNPDFDSHGWTLESVRAILDHVE
    PEREVIRGLKDFGVMDVNDACTLTPTCTNLCPTDAIQRTGEGELAFNHADCVNCGLCEEGCPETAITMHDGLDLSLLPEN
    RGGEAWVTVHEGDMLECVRCGKPFTSVASADKIEEEVGDQVEGLAPDADHSVFEYCSDCRSRLLFDQGEKR

    >gi|55378156|ref|YP_136006.1| thioredoxin [Haloarcula marismortui ATCC 43049]
    MNARKTITIAFFLVVLGVGYYSMNAAPVVRDDAHTYQGGLEWETDPGTALDAAQSQDKPVLVYYWATWCTYCERYDKNHY
    RNETIRAAMDDYVLLAINIDDPGNGTALVRQHQATYPPQHRIMTPNGDTVESVEGYIGRDELLATLEKRSEEAT

    >gi|55378270|ref|YP_136120.1| peptide methionine sulfoxide reductase MsrA1 [Haloarcula marismortui ATCC 43049]
    MTPSAYEPTHPTALAADAEAPPPSATATATFGMGCFWGPDARFGATPGVVRTRVGYAGGTEPDPSYYSLGDHTEVVQVEY
    NPDTVSYEALLDVFWANHAPFSAPLKRQYRGVVLAHDDQQCEAAKRTRDDLESRTGKSVETAIETLDQFYLAEDYHQKYE
    LRSTPVVADELEDTYGDAFVDSTVAARLNGFVAGHGEDDEREALFAELDISPAALSEVRRRL

    >gi|55378626|ref|YP_136476.1| DSBA-like thioredoxin domain-containing protein [Haloarcula marismortui ATCC 43049]
    MNRRRFLTLSGVGVVGAVAGCSSEADSAESVDNHPAAADLDAQPRRGELGGHVILAFEDPSCPTCRRFHEETLPDIRENI
    VDAGKGAYVVRTYPVIYPWGEPATQALESTFARDSEAYWALFEHYFAEQSSFDPDNVLDRTAMFLTEETAVDGEAVARDA
    QEQAHNDAVQADIQAAEDAGLGETTPIILLFEDGEFVTKVNGSVSYDLIAEALGERDG

    >gi|55378739|ref|YP_136589.1| methionine sulfoxide reductase A [Haloarcula marismortui ATCC 43049]
    MMTEQATFAGGCFWCTESVFKQINGVTDVVSGYAGGHVADPSYEAVCREETGHAECVQLTYDPEEVSYEDLLAVHFTTHT
    PTTKDREGNDVGTQYRSAVFYHDEAQRETVEALIEEIEPGYDSDIVTEVEPLETFYPAEEYHQDYFEKNPDQSYCQLTIP
    PKIEKLEETHEELLRAD

    >gi|55378797|ref|YP_136647.1| hypothetical protein rrnAC2088 [Haloarcula marismortui ATCC 43049]
    MRVVTLLPSATEIVYALGVEPVGVSHECDHPPAAREKPSVNRSRVDPTASSGEINEQVAAVEESDGVYAIDRETLAELEP
    DLIVTQGVCDV
    CAVDHVVVAEAVEELGLDTDVLTLDVHSLDGLFESIHRVGAAVGRDERAAELVADLRERVAAVETTATR
    GETTPRVAVLDWLDPVMAAGHWVPEMIEMAGGTYGMEEDGAHSRPREWEEVVEYDPEVLVAAPCGFDVAQTRENLTDLTR
    RPGFDDLTAVRDGRAYVIDGHHYVNRSGPRLVDTLEFLAALVHPDLFETPPRDAVVELGTVRA

    >gi|55378799|ref|YP_136649.1| molybdopterin biosynthesis protein MoeB [Haloarcula marismortui ATCC 43049]
    MRPDLDPEQLDRYSRHIIMNDVGPEGQATLLDTDVLVIGAGGLGAPVLQYLAAAGIGRLGIVDDDVVERSNLQRQVIHKD
    DDVGRSKVDSAAEFVTGLNPDVTVDRHELRLARENATDLVADYDIVVDASDNFATRFLVNDACTLSGTPFSHGAIFQFEG
    QVTTFSGDSPCYRCLFPEAPPEGTVPD
    CATAGVLGVLPGTIGCMQATEVVKLAMDYGETLEGRLVAYDAAEMSFEEVPIA
    PKPDCPVCGDDPAIASVADASYEGRCSLAED

    >gi|55378817|ref|YP_136667.1| thioredoxin [Haloarcula marismortui ATCC 43049]
    MTVTLKDFYADWCGPCKTQDPILEDLEEEWADVEFEKINVDEEQDVANEYQVRSLPTLIIENDDGIVERFVGVTQADDID
    DALQQASA

    >gi|55378832|ref|YP_136682.1| thiosulfate sulfurtransferase [Haloarcula marismortui ATCC 43049]
    MMTDFVSAEWVSSRGDDLRVVDVRDAWEYDGLGHLPGAVNVPFDSFRADEHGAESDAGDGMLPDEGDWAELLSEAGITPE
    SDIVAYDDHHGVFAARFLVTAELFGHDPDRLHLLDGDFSSWQLERETTSETPTVEPTDYEVTRPDSTPLVGPDAVADAAD
    DPDAVLVDTREDEEYDAGHIPGAVLLDWRNLVDNETRGLLPQDEALSVLEAAGIVPGKRVVLY
    CNTARRISHTYVVLRHL
    GFEQVDFYEGSLTEWEAQGRPLETN

    >gi|55378833|ref|YP_136683.1| thiosulfate sulfurtransferase [Haloarcula marismortui ATCC 43049]
    MSGRLTLRCIMTDYANDVLVSADWVSEHLDEFQSDDPAHRLVEVDVDTELYDESHAPGAIGFNWETDLQDQTTRDILDKD
    DFEDLLGAHGISEDSTVVLYGDNSNWFAAYTYWQFKYYGHDDVKLLDGGREYWVENDYELTDEVPEFSEVDYEAAGPRES
    IRAYREDVENAIERELPLVDVRSPEEFSGEILAPPGLQETAQRGGHVPGAQNISWAAVTNDDGTFKDYDELEELYAEYGI
    DGDSTTVAY
    CRIGERSSVAWFALHELLGYDDTINYDGSWTEWGNLVGAPIEKGEADD

    >gi|55378852|ref|YP_136702.1| putative rhodanese [Haloarcula marismortui ATCC 43049]
    MDGEIDADELRSKLDEETVRVVDIRSPGAFERGHIPESENVPFPSLVDEVERFEGDDEVVTVCPKGKSSVQAARLIASYE
    GFDGDVVSFAPGLNGWDGPLERAEDEETPADTAAADRDSDEGPAAPF

    >gi|55379114|ref|YP_136964.1| thioredoxin [Haloarcula marismortui ATCC 43049]
    MSETQSSERITVFSDYVCPFCYLGRESLRQYQSTREDELEVDWHPFDLRSGKRNPDGSIDHSVDDGKDDEYYEQAKESVR
    RLQAKYDVEMDLDIATDIDSLPAQIASYYVKEHYDYETWLAFDVAVFEALWQDGQDIGDEDLLVELAEDAGVDGDEIRSA
    LADGALRSEVRENFTAAKRQGITGVPTFAYDGHAARGAVPPEQLERLVEGS

    >gi|55379121|ref|YP_136971.1| thioredoxin [Haloarcula marismortui ATCC 43049]
    MDTTTEHSVRTVETRDELDDVLATADHVLVMVRTTGCTICKSMEPILDIAAKATDATVVVFNPKHDLDAVDAFDVRSVPT
    FLLFADGDLIHRRADGFVPAEDLIEFVERGLESRT

    >gi|55379179|ref|YP_137029.1| glutathione S-transferase domain-containing protein [Haloarcula marismortui ATCC 43049]
    MANLELYELEGCPYCAKVTKKLDELGLDYESHMVPRPHGERTEVKEVSGQTGVPVLIDEDNGVDGMPESDDIVEYLEKTY
    GQ

    >gi|55379246|ref|YP_137096.1| glutathione S-transferase [Haloarcula marismortui ATCC 43049]
    MSESDITLYRLQACPFCERVVRKLNEYGLDYQSRFVEPMHADRDVVKRLSGKRTVPAIVDESTGVTMSESANIVAYLERT
    YGEGEETAGGAA

    >gi|55379538|ref|YP_137388.1| bacterioferritin comigratory protein [Haloarcula marismortui ATCC 43049]
    MVLEPGTDVPTIRATNQHGDAVQPNFEQPTVLYFYPADDTPGCTTETEQFEEHAQRFEDTGVSVYGVSTDGVESHRDFAE
    ANDISFDLLADPEGRLCEAFDVPLVDGRSQRTTYVIARERVVAVYERVGPDGHAASVFEDLVDTGLVSAE

    >gi|55379543|ref|YP_137393.1| dihydrolipoamide dehydrogenase [Haloarcula marismortui ATCC 43049]
    MVVGDVTTGTELLVIGGGPGGYVAAIRGAQLGLDTTLVERDAYGGTCLNHGCIPSKALISASDVAHDARQAESMGVFADP
    AVDMAGMTEWKDGVVTRLTRGVESLCKNAGVNLVEGTAEFVDDGTVRVAHGGEGQGSESLSFEHAIVATGSRPMAVPGFE
    FDGEHILSSKDALALESVPEKLLVVGAGYIGMELSTVFAKLGAEVTVVEMLDDVLPGYEDDIATVVRDRAEELGIDFNFG
    EAADNWEETDEGIRVQTVDEDEVVTEYNAEKCLVAVGREPVTDTLALDNIDLQTDENGVIPTDDQCRTAFESVFAVGDVA
    GEPMLAHKAMAEGEVAARAAAGEPAAFDHQAIPAAVFTDPEIATVGMTESEAEAAGFEPVIGQMPVRANGRALTVNEKEG
    FVRVVADADEEFLLGAQIVGPEASELIAELGLGIEMGARLEDIAGTIHTHPTLSEAVHEAAAAARGEAVHTR

    >gi|55379651|ref|YP_137501.1| hypothetical protein rrnAC3079 [Haloarcula marismortui ATCC 43049]
    MGRQATKFQAGAGRTGGMADSDTVMARFDTPDIDDLPEDLQERIAEETDRAGFTPNIFPAMAYRPSHFRAFFAYHDALVE
    ETALEREEVEMIIVAVSGVNDCLY
    CIVAHGALLRIYADAPKLAEQVAANHRTAEINETHKAMLDFAVKLTESPARIEDED
    LERLEEHGYSRRAIWDIGSVAAFFNLSNRLAQLADIRPNDEFYNLGR

    >gi|55379691|ref|YP_137541.1| thioredoxin [Haloarcula marismortui ATCC 43049]
    MSDTQSPESLLDALQSEGVVVIDEETDEVSTTEAFEADREVYYDTYVTMGNAEFHESVADVFGLDSAAEAAQRVDELDVS
    REEFATFLTLRSNVDDSYTTVELTTMAQMATELGPETPVPEGVKHLDDDSYEAFVDAHDRCVVTVWKLF
    CDPCEAMKAEL
    DDVLAAFPDGVPVGGIAGERSPEFCQSVGVNAAPAVVLFEDGKPVERITGRTDPSPLAERVEEVYGV

    >gi|55379892|ref|YP_137742.1| bacterioferritin comigratory protein [Haloarcula marismortui ATCC 43049]
    MVVQITLAGHAAATQRRVGVPGQHRIMLEPGAPAPDISAQNQFGETVSPDFDAPTVLYFYPEDFTGGCTIEARDFQEQLP
    QFREGGITVYGVSMDDVATHDEFAEEEGLLYDLLADPDGTVAEAFGLDTSGGRTDRRTFVLADGEIKSVYDPDISDPDGH
    AEAVLRDVRNEFVQGG

    >gi|55379920|ref|YP_137770.1| dihydrolipoamide dehydrogenase [Haloarcula marismortui ATCC 43049]
    MTHVVIIGAYGSAGAAVAGDLVEAEDIELTLIDNGEPGGGLCILRGCMPSKEVLSAGAHRFQARHDERLVGDVPEVDLEA
    VVERKDDHVLDWAGHRRDSVHEMAERDDVTFIHDTATFVDEHTVRAGGEEHEADYVVIATGSSVNVPETPGIDEVDFMTS
    DQVLDATEFPDSGIVMGFGYIGMEMVPYLAEAGGMELTVIEHDDRPIDEGDPEFGDEALDIYENNWDVTIPTNCYEKELE
    ETEDGGVRLTVEYDDGSEETFEADQLFLFTGRRPTVEGLGLENTPVSVDGDWARDTMQTRDADHIYAVGDVNGKEPILHV
    AKEQGFTAAENIVRQEAGGSLEAYRNVHHHVIFSGLGVYPFARVGHNEETAKEAGYDIVTATRQASDDGVFKSKDVPEGL
    AKLVVDADDGTVLGWQGMHYHADSFAKTFQTIVELGLDVRDLPDRAYHPTLPENVDGLIRDCVDQL

    >gi|55379989|ref|YP_137839.1| bacterioferritin comigrating protein [Haloarcula marismortui ATCC 43049]
    MVSTGDTAPDISATIANGEVEDFELSDHLGDGPVVLAFFPGAFTPPCSNEMVALQEHLGDFHDAGATVLGLSADSAFSLN
    SFRDEHGLEFDLLSDMGRSAIQDYGLEIDIEDLGLLGVANRAVFVVDDDGEVAYSWVADDPTNEPDYDELLDAAESA

    >gi|55380238|ref|YP_138087.1| dihydrolipoamide dehydrogenase [Haloarcula marismortui ATCC 43049]
    MVVGDVTTSTDVLVIGAGPGGYVAAIRAAQLALDVTLVEKGEYGGACLNRGCIPSKALIHGSKLASEAGQAEELGIYADP
    TVALDEMINWKDGVVDQLTSGIEQLCTAAGVNLLKGTAEFADENKVRIIHQGEGQGSESLKFENCIIATGSRPIEIPGFG
    FEDERIVSSDGALNFDTVPDELVIVGAGYIGMELATVYSRLGSDVSVIEMLEQALPSYEEDIASIVRKRAERLGVDFHFG
    YTADSWAASDGKAVLTAVPADEAAHDSDIELTADRILVAVGRRPVTDTLSIDDAGVETNAQGFIPTDSTCRTNKEHIFAV
    GDVAGEPMLAHKGSKEGEVAAEVIAGEPAAVDYQALPAAVFTDPEIGTVGLTENEAANKGMTPVTGEFQFQASGRALTAN
    RAEGFVRIIATKETERVIGAQIVGPEASELIAEIAAMIEMGAKLEDIGSTVHTHPTLSEAIMEAAQNAREKAIHRRN

    >gi|55380298|ref|YP_138147.1| zinc-transporting ATPase [Haloarcula marismortui ATCC 43049]
    MTENPDAAEGAGGDGQRQERTVRLTVPEMDCPSCAQKVDKSLQRVDGVVDATLQPTTGTAAVTYDPERTSGTDVVKAIEA
    AGYEVSGGPDSDAAEQAETGGGADIAPPSEVWTSPRAKKTWLGAALVTFGLLFKFLLTAQNVAVASALGYPLSVADALFL
    GAVAVSGVPVVRSGYYSAKNLSLDIDLLMGTAIIAATGIGYFVEAATLAVLFSIAELLEDYAMDRARDSLRELMELSPDE
    ATVVRDGEEVTVPADEVEVGETVAVRPGDKIPLDGTVVDGESAVDQSPITGESVPVDKVAGDEVYAGAINEEGYLEVTVT
    STAGDSTLSRIIEMVQGAQAKKTDTEQFVDRFSGYYTPAVVVLAILTAAIPPLVIADPVSVAVAGYGVTFVGDWQTWFIR
    GLTLLVIACPCAFVISTPVSVVSGITSAAKNGVLIKGGNYLEAMGEVDAVAVDKTGTLTKGELAVTDVVPAGDTDAATLL
    SHAAGLERRSEHPIATAILTRATEDGVEDLPAVTGFETLTGKGIRGEIDGEIYYAGKPALFEEVGFDLSRTRREADGVLR
    SGATGDSSDHRSDGGVVSEETPASGGGAFAGNTLAALEREGKTVIIVGTDSELLGAIAIADEVRPASKQAVERLQALGIE
    RVVMLTGDNEGTARAIADTVGVDEYRAELLPDEKVDAVEELQAEYGTVAMVGDGINDAPALATAEVGIAMGAAGTDTALE
    TADIALMGDDIGKLPYLYELSHTATDVIRQNIWVSLGVKLLLALGVPLGLVSVALAVVVGDMGMSLGVTGNAMRLSRIKP
    DRFFDA

    >gi|55380304|ref|YP_138153.1| thioredoxin [Haloarcula marismortui ATCC 43049]
    MTDELAEIRQKKLEELRNGERGTAAENENSESAAEPVHVHGAGDLQDTVDDGVVLVDFYADWCGPCKQLEPVVERIAAGT
    AATVAKVDIDANQQLAAKYGVRSVPTLLLFVDGEPVERLVGMQQEPQLRSLIESYT

    >gi|55380312|ref|YP_138161.1| hypothetical protein rrnB0286 [Haloarcula marismortui ATCC 43049]
    MNAEDFPTPDADVESVTPETLKSRIDDGESVTILDARMSGDYEEWHIDGENVESINVPYFHFLEDELDADIIADVPDDRE
    VTVL
    CAKGGASEYVAGTLADRGYDVHHLEDGMNGWARIYETVEVTDYDGAGTLLQYQRPSSGCLGYLVYDDGEAAIIDPL
    RAFADRYFDDADELGVDLKYALDTHIHADHISGVRGLDAAGVEGVIPAAAVDRGVTYAAEQSSASPVSQARQDADDLTTA
    EDGDTFEVGDVTIETVATPGHTTGMTSYLVDDSLLATGDGLFIESVARPDLEEGDEGAPDAARMLYESLQERVLTLPDDT
    LIGGAHFSDAAEPANDGTYTAPIGQLVEEMDALTMDEDDFVETILADMPPRPANYEDIIATNLGQNTVDDEEAFTLELGP
    NNCAASQESLAGD

    >gi|55380313|ref|YP_138162.1| hypothetical protein rrnB0287 [Haloarcula marismortui ATCC 43049]
    MVADPVPLQLAAELFPNGISRYAIGGLFVGLGAAVIYVGTGISAGASTFLESTLSYVSGQSRFQQYVASRDWRLVFTLGI
    ILGAAVYAVVYQGGAWTTDVSWWRLLLGGIFVGIGTRVGKG
    CTSGHGVCGVGSASKTSLAGVLAFLLVAILTAQVVAALG
    VTP