Acidilobus saccharovorans 345 15 uid51395

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302348009|ref|YP_003815647.1| Protein-disulfide oxidoreductase [Acidilobus saccharovorans 345-15]
    MAGRYFDVELDEELIKELKDTLAYMVSPVTVDLFIDDASRCETCEDAYKLVKTIADASPVRDGKKMLQLRVFSKSKPEDL
    EEFKRQNVERVPTVTLLGGVIRYTGTPAGEEIRGFIETIMRISEGESGLDPETKKQLASLKGSVHIETVVTPS
    CPYCPYA
    ALLANMFAYESWKQNNPKVISDTVEAYENMDIAEKYGVMSVPAIALNGVMSFIGVPYEEDFINYVVAAAENRLDQLVPKT
    EGEASGM

    >gi|302348058|ref|YP_003815696.1| Thioredoxin reductase [Acidilobus saccharovorans 345-15]
    MSLRLGALPQFKVPPKGEHYDVLIVGAGPAGLSAAVYASRFLLKTVVVSEDVGGQLNLTNVVDDYPATLSISATELISRF
    REHAEKLFGVPIYTNITVQKFSREGDEYHVTGTRGLDVYSKTIILAVGSRRRKLNVPGENEFAGRGVSY
    CSICDAPLYKG
    KEAVAVVGGGDAAFEGAILLSGYVKKVYLIHRRSEFRAKPFYVQEAMSRPNIEFVLNSVVTEIKGDKLVRSVVVKNNVDN
    SIRELNVDGVFIEIGFEPPKDWYQSLGLEVDELGYVKTDLWMKTNLPGVFAAGDAISLWRGFRQIVNAAASGAIAAYSAY
    TYLTEHGLVRRPALASKEAAK

    >gi|302348295|ref|YP_003815933.1| Methylated-DNA-protein-cysteine methyltransferase [Acidilobus saccharovorans 345-15]
    MNSLDERVYEVVKAIPRGKVTTYKAIAELLGVSPRAVARALKRNPRPIEVPCHRVIMSDRSLGGYAFGGPEVKRLLLLSE
    GVRFDEKGKVLEDFIVRDLRSIDKNLWVTSRNT

    >gi|302348378|ref|YP_003816016.1| heavy metal translocating P-type ATPase [Acidilobus saccharovorans 345-15]
    MSENERRPLRIGKEEQLRVVGMHCATCSTTVAKALRGVKGVEEAEVNLASGTAKVVVSGARLRDLVEAVRRAGYDVVTER
    LRLRISMNPEDSRRVTELLEGLDGVVKASVNPGTGEAVIEVNPYSTSAEAIVEALRGHGFRAQVISKAAPASAGELRGYL
    RALAVAWSFGLLTLYLQYTSRPLLAMVASAPVVFYAGLRYHLGAYRAFRNRTTNMDTLVSTATLVAWLYSAYSLAVHGPV
    FFDAASLLISFLLIGKTIEAYIKERLSGEVVRLLPSRARVIRDGSEVEVSADEVKVGDLLVVRSGESIAADGVVDEGKGE
    VDESIVTGEPMPVTKSKGDPVVGGSRLVSGFLKVYVTRSGERTYMAQLMTAVRDAEAARLRAQDLVDRVAAVFTPTIIAI
    AVVTFLAWHFALGFPTPKAVLFAVAVLASACPCALGLATPMAVLVSVHRLAKRGVIVKDGEALERVKDVDVFVFDKTGTL
    TEGRPRVKDYVELQPGVMELAASLESLSSHPVAKAIVDRFGARLRGSVKDFNEFPGDGVAGTVGDRQVIVGRPEFVAQNC
    EGQAKGDVAVCVDGRVAGWLSLEDPVRPEALELVAKLKSMGRRVIIATGDSGPSAEAVAAALGVEVRKGLSPDDKAELVR
    SLRQEGHRVAFVGDGVNDAVAEKEADVGIALAGGTDIAKYAGDVVVMNLKGIELLLRESRIATRKVKENLAWAFGYNSVL
    VPVAAGLLYPAVYLSPQYAALAMSMSSVIVSLWSTVPL

    >gi|302348381|ref|YP_003816019.1| Peroxiredoxin [Acidilobus saccharovorans 345-15]
    MSYMVQVGDQVPDLELETTAGKVKLSDFRGKKLVLYFFPKAFTMGCTRELKRFTELYDQFKALGAEVIGVSVDSVDTLKR
    FAEKYGAKFPLASDKAKEVSKTFGVLKLMTASRVTFVIGPDGVVRQVISNLKRAEEHADRALEAVKSI

    >gi|302348384|ref|YP_003816022.1| Peroxiredoxin [Acidilobus saccharovorans 345-15]
    MSASEVISQERMPLIGEKFPEVEVATTHGRLKLPDYFTSKGKWFVLFSHPADFTPVCTTEFYSFSLYYPEFEKLNTGLIG
    LSVDGNPSHISWVQWIERNLKIKVPFPIIADPLGLVARRLGMFHAQSATNTVRAVFFVDSKATIRAIIYYPLELGRNVKE
    ILRVVKTLQLIDKTGAVAPANWPNNEIIKDNLLNPTPASVEEASLRLTQFKGYDWWFTFREAPREDVEEAKKYAP

    >gi|302348404|ref|YP_003816042.1| predicted transporter component [Acidilobus saccharovorans 345-15]
    MITYTAPMWVGLIIGFIIGAAAEAWGIANPETLIRLAKWEDRLFLDCIALGFAIGTPVLFGLYALGVGFHWGPKPLYVIG
    VGLGGVLFGSGLALSGYFPGSIWMALGEGRRDAVYALFGAILGAATWTAMYQDPAIRKALVGTLNFGSQIIGATHPSGAE
    YLVPWPGLNRYSLFGIALVYGIIMFLIAYYVPRYRGGSRSCLRANIEKRVTPVEMKMHEDTARYLTDGALPYKKGSLAQK
    LNEYYAVESNVTRWFMVSVAGIVALTVVAEMFLHQIFGESTTDSWIAGHLFMPNFAYSKIVFKGIGWEPYSDIGTLMGSF
    FAAIFLTRRFTAFRNIIPPSWAERFGTNSAVRFLGSFGGAYLMLLGARMADG
    CASGHILSGGLEMALSGLEFAGFVFLSM
    VLVGRVYYQRRR

    >gi|302348549|ref|YP_003816187.1| Predicted transporter component [Acidilobus saccharovorans 345-15]
    MPQEAEEKRDREAYWTISGVLLALAIILLGLGLYFQLDLHHQPAPLLLGILAGFVLATPLEIWNWGDPDIVWRVVSFQDR
    FLMVCFGFAIGLGALLLYGLYLIPGTAPHFGIKDFFVPGIVVGGLLFGIGVGLSGYFPGLIWISLGQGRRDAIYAVIGGL
    LGALTWSLIFGAARGFFWNTLNFGPITWATLAGFSMSDRLGYFAVAVVFFIIMFSMFMFLPRYPGQPVRQSCAYHLSGAS
    KESTVWEEVVAEEMRKYPKANKFITRLTNESSIRNSRSIILLGIAFTVTAVAVIYLRQIFGESTTFSWIGAQIAYAINPR
    WAAANPYWQLFGGLGFKNGVPYDKPFSEIGWEPFSDLGTFLGALISSLFVTRRFMGYRRQVPTLWARRFGDSEAKRALGS
    FFGAYLVLFGARMANG
    CASGHILSGNTQMAISSFVFMIFVLIGAWITLYGVLGLRINKWGFRK

    >gi|302348564|ref|YP_003816202.1| Dinucleotide-utilizing enzyme [Acidilobus saccharovorans 345-15]
    MASADVAEVLSRFSREALVKGIGQEGVKRLRESRVAIIGCGALGSTEAELLARSGVGFLRVVDRDVVDYTNLHRTHMVGE
    AEAEQGVPKAIACRDGVARIDRSVKVEAYIDDVDSDNIEDIVKDVDIVLDGTDNMDTRFVINEAAVKYNKPWVYAGVNSW
    YGTVMLIEPGRGPCLRCLIPEGQEGQQAS
    CDIIPAIGTVTTIVGAMAANLAIRYLAGDGPEPGVLYSIDARENTVEKVKV
    ERNPSCPVCVRREFKLLSRPPRFGVISRVCGSEAFKLRLPLDAPEPQDLASRLSSRFSWVVSRPNYVKVVTKEGVSVTVL
    GRRVVVIEGAMNEDDARRAYDEVAEAAGLPTY

    >gi|302348730|ref|YP_003816368.1| Alkyl hydroperoxide reductase subunit c [Acidilobus saccharovorans 345-15]
    MIEVGSPAPDFTANAYFPAENRVGKLSLHDFKGKWVVLTFHPGDFTFVCATDLEAFQAYYDKFKANNAEVLAVSTDSVYS
    HKVWVETSPRVKGVKFPLVEDINKQISTAYGFLNTATGMTRRGTVIIDPDGIVQYISVFNDRLGKDVPHIYNAFINLKYL
    YEHPPTPTEFDIVSANKGEGSQVLHIRIPDSIGKL

    >gi|302348787|ref|YP_003816425.1| Thioredoxin [Acidilobus saccharovorans 345-15]
    MSAENDDEELRRILQKKKEELLAKLSSQSTEGDSSSGNGSQEPPVAELNDSSFDEFIASHRAVVVDFWAPWCAPCFLVAP
    IIDDLALQHKRIAFARVNADASPETASKYYVMSLPTIMFFLDGQEVDRVVGAVPEEVLEERVQWLESKL

    >gi|302348826|ref|YP_003816464.1| NAD(P)H:elemental sulfur oxidoreductase [Acidilobus saccharovorans 345-15]
    MNALSRIVIIGSGAAGMSAASRAKRLKPSNDVIVIDSSRWVSFAFCGLPYLVGGEVKDLDELLYYPPSEFTKRGIDLRLN
    KTVIEVDPDSKKLIYVDNSTGTKESLEWDKLVLATGARSKAPKLWPEIRGARNVFYIVHMESGQQIRDYARSLGPGKRAV
    VIGAGYLGLEMADNLAKLGLKVTIIEALGQVAPRMLDPELAKIVEDNIRSKGVEVVTGAAVERFNIINNTATEVVTSKGT
    YQGDMFVVGVGIEPNNELAKQLGLKLGQSGGIIIDERTLTSNPDVYAAGDVTEHKDLVTGQLVWRPFAQIANKMGHVTGS
    NLGGVDSVFLGSVGTSAFKVFDVVAARTGLSASEASKVGFKPVEVSLEAGTKAHYIPGGSKISLKVVADEKTGRLLGAQA
    VGFDETAFWRINVVASLLTRGGTVWDLFNADYGYQPLLSPVWDPLVIAARLLMRTFGERPW

    >gi|302348861|ref|YP_003816499.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide E3 component-like enzyme [Acidilobus saccharovorans 345-15]
    MKLPEKVDVVFIGGGGASYPGAFELAEAGLSVLMVDEKGNLGGDCLYAGCIPSKTVRTKILEYTSTTNRIDPEQIWQEVV
    KAKEEVQRIRYEHHMEEIKEHEPNLSFAKGWATILGPNKVKVDTEEGTFEVETKRLVIGAGAEHVIIPIPGKELAITSDA
    LFAYQKTMGHLPKSLAIVGGGYIGVEVADMLSRLGTHVSIVEMMDRLLPNMPPELSEAAMQRMKEAGVDVYLRSPAQSIE
    KRGEYKVLKAKSADGKEVEVEAEEVLMAVGRRPRTRGYGLEALESQGLKVDKTGVQVTPGLRTTLPNVYAAGDVTGKAML
    FHAAVKESVIVAKNILTGKEVYRFNYHSVPYTIFTYPEIAMVGYTEDELKALGIQYEVVNYSLKHDAQSEIVGRREGWMK
    ILLERESLRILGFEAYAHDAAELSAVFAAAIENNLTAKNLAWMAGPHPLTFESINYALRPYF

    >gi|302348953|ref|YP_003816591.1| Thioredoxin [Acidilobus saccharovorans 345-15]
    MNGEEKEANPWIDLSEKLEERALYLEKVLKEFIIDVSSTNLDSLLKENRIVFLYFTAEWCGPCINFYKTFKDVATELLVP
    GVAFGKVDVDAAYSVADKYQVRHIPSILIIADGKVVDTIVGQVGKDELKRRMSTYVGRASK

    >gi|302349101|ref|YP_003816739.1| hypothetical protein ASAC_1303 [Acidilobus saccharovorans 345-15]
    MAGVPLFKVNPWVDAAFYAVLGFLFGVLAERTTYCIVVATHQVMGVKYSKVYEMILVGVAVSSLLTGLLVASGLVPAVDA
    YFKVPGAGWYTLLGSFIFGFGIMLGQG
    CMVGMLWKAGQGYLVNWLEIAGMIAGTVIFAFPVFDGLNLNWWWHHDTSLSIM
    NGAPQNYVPNLLDSFLSLRAAAALTGVIFFAGIMAAALWLRHNRLAWTGGERGKIWSSPYLLGTVFGLFMVASFVFLAGR
    DFNYLGVTTPVGLLGEYLTAPFGGVLGSASMPNNWFQTVGIASVFTFFILMILSGAMVSAIWRGTFSIRLPARNTNAAAE
    MAIAFLGGVILAIGARMAQG
    CSVGGFWSGLAALSLFGLVFTVGFIPGTIAGYYAYVAMSSAAARRVKTIRQLSSIELKVG
    NVDVSGLVVAVLWSMVLGAVGIELRAFNSALRVHMSPAAVSQWSAVMEVAAVVVLLLAVVGWLRRGSAASR

    >gi|302349169|ref|YP_003816807.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide E3 component-like enzyme [Acidilobus saccharovorans 345-15]
    MKLLSGALTVDVALIGGGGASYPGAFELARAGLRVALVDDREFLGGECLHSGCVPSKALREWALKVDEAVSIGAKVDPDE
    VWRRAVDAKDRVQSQVFSQLKWMAEQLSERLTVLRGWATIVSDRELRVRTQEGELTVNFRYLHIGAGSVNVVPRIPGAEL
    CMTSDDLYTYMRTPRELPDSVAIVGGGYIGVEAAEVLSRFGVKVTLVEMMDRLLPNMPMDLSRAALRALQRRGVDVRLGY
    AASSVERRGQAKVLRATSRDGGSIEVRADEVIMAVGRRPRLEGYGLEVLGLDVGPGIKVSPGMRTSRENVFAAGDVTGKA
    MLYHAAVRGSLVAARNILVGREAYRMSYLDVPSVVYTVPEMGYVGYTEEELRAMGVKFDVIRYSMKANSYTLMLGHQDSW
    VKVLVDEPGRVLGAQAFAPEAHAILTAFAMAMGSGLDAERLYWLAPPHPSPMEVLAEAFRQA

    >gi|302349199|ref|YP_003816837.1| NADH oxidase [Acidilobus saccharovorans 345-15]
    MEILVIGGGAAGMSAASWARRRAPDARITVLERTNIISHAPCGVPYYIGGLFKDYWLLQAYDVKFFRERRNIEVITNAEA
    EELDVKSRVAVARMGGQRVKLEFDRLVIATGARPRRLNNVDDAKVIYVHHPADAETARRAAEAAREVTVVGGGVLGVEMA
    EQLRNMGKVIHLVHRGPYLMSRDLDEELGSGLTEMARRAGVDLRLGVTVAEASGDRVRLSDGSELRSDLVVAAVGVEPDV
    DLVRGQLRLGPHGAIAVDDRLQATYDYAFAAGDAMEHRNMVTGQPDWRPLAPIANKSGLVAGVNAAGGDKRFPGVLGDIV
    TRFEGVAFGRVGLNEAEARRANIRYVTSIITTRSRARYYPGGGDVTVKLLAEESSGVIIGGQVAGPEEVIGRLGVIAAAI
    MKRMTAEELFFVEIGYHPSSGRAWDPVVLAARQLMRI